KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_00503Help
Entry
NCTC1_00503       CDS       T03751                                 

Gene name
nfnB
Definition
(GenBank) dihydropteridine reductase,Oxygen-insensitive NAD(P)H nitroreductase,dihydropteridine reductase,Nitroreductase family
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00633  Nitrotoluene degradation
sft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NCTC1_00503 (nfnB)
Enzymes [BR:sft01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     NCTC1_00503 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     NCTC1_00503 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CDX05778
UniProt: A0A2Y5B414
Position
1:complement(502036..502689)
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNKRKILDASHVVVFCAKTAMDDAWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNTTLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgtcgccttaaagcgtcattccactaaggcatttgatgccagcaaa
aaacttaccccggaacaggccgagcagatcaaaacgctactgcaatacagcccatccagc
accaactcccagccgtggcattttattgttgccagcacggaagaaggtaaagcgcgtgtt
gccaaatccgctgccggtaattatgtgttcaacaaacgtaaaatacttgatgcctcgcac
gtcgtggtgttctgtgcaaaaaccgcgatggacgatgcctggctgaagctggttgttgac
caggaagatgccgatggccgctttgccacgccggaagcgaaagccgcgaacgataaaggt
cgcaagttcttcgccgatatgcaccgtaaagatctgcatgatgatgcagagtggatggca
aaacaggtttatctcaacgtcggtaacttcctgctcggcgtggcggcgctgggtctggac
gcggtgcccatcgaaggttttgacgccgcaatcctcgatgcagaatttggtctgaaagag
aaaggctacaccagtctggtggttgttccggtaggtcatcacagcgttgaagattttaac
gctacgctgccgaaatctcgtctgccgcaaaacaccaccttaaccgaagtgtaa

DBGET integrated database retrieval system