KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_01031Help
Entry
NCTC1_01031       CDS       T03751                                 

Gene name
torS_1
Definition
(GenBank) hybrid sensory histidine kinase TorS,Sensor protein torS,hybrid sensory histidine kinase TorS,Uncharacterized domain of BarA-like signal transduction histidine kinases,TMAO reductase sytem sensor TorS,Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  KO
K07647  two-component system, OmpR family, sensor histidine kinase TorS [EC:2.7.13.3]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sft00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC1_01031 (torS_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sft01001]
    NCTC1_01031 (torS_1)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sft02022]
    NCTC1_01031 (torS_1)
Enzymes [BR:sft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NCTC1_01031 (torS_1)
Protein kinases [BR:sft01001]
 Histidine kinases
  OmpR family
   NCTC1_01031 (torS_1)
Two-component system [BR:sft02022]
 OmpR family
  TorS-TorR (TMAO respiration)
   NCTC1_01031 (torS_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA Response_reg Hpt HAMP HATPase_c_2 KR T3SS_ExsE
Motif
Other DBs
NCBI-ProteinID: CDX06277
UniProt: Q83MM0 A0A383JY19
Position
1:complement(1000882..1003311)
Genome map
AA seq 809 aa AA seqDB search
MLQALREQGFDTTAIEQQEQEISRSLRQQGELVGRRLQLRQQQRQLSQQIAAADEIARLE
QGQANNATTSAGATQAGIYDLIEQDQRQAAESALDRLIDIDLEYVNQMNELRLSALRVQQ
MVMNLGLEQIQKNAPTLEKQLNNAVKILQRRQIRIEDPGVRAQVATTLTTVSQYSDLLAL
FQQDSEISNHLQTLAQNNIAQFAQFSSEVSQLVDTIELHNQHGLAHLEKASARGQYSLLL
LGMVSLCALIMILWRVVYRSFTRPLAEQTQALQRLLDGDIDSPFPETAGVRELDTIGRLM
DAFRSSVHALNRHREQLAAQVKARTAELQELVIEHRQARAEAEKASQAKSAFLTAMSHEI
RTPLYGILGTAQLLADNPALNAQRDDLQAITDSGESLLTILNDILDYSAIEAGGKNVSVS
DEPFEPRPLLESTLQLMSGRVKGRPIRLATAIADDVPSALMGDPRRIRQVITNLLSNALR
FTDEGHIILRSRTDGEQWLVEVEDSGCGIDPAKLAEIFQPFVQVSGKRGGTGLGLTISSR
LAQAMGGELSATSTPEVGSCFCLRLPLRVATAPVPKTANQAVRLDGLRLLLIEDNPLTQR
ITVEMLNTSGAQVVAIGNAAQALETLQNSEPFAAALVDFDLPDIDGITLARQLAQQYPSL
VLIGFSAHVIDETLRQRTSSLFRGIIPKPVPREVLGQLLAHYLQLQANNDLPLDVSQLNE
DAQLMGTEKIHEWLALFKQHALPLLDEIDIARASQDSEKIKRAAHQLKSSCSSLGMRSAS
QLCAQLEQQPLSAPLPHEEITRSVAALEA
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcaagcgttacgggaacaaggttttgataccaccgctattgaacaacaggagcag
gagatctcccgttcattacgtcagcaaggggaactggtggggcggcgtctgcaactacgc
cagcaacaacggcaactcagtcagcagatagctgccgccgatgagatcgcacgcctggag
caaggtcaggcgaataatgcgacaacttccgctggagcgacccaggccgggatttacgat
ttgatcgaacaagatcagcgtcaggctgctgaaagtgcactcgatcggctgattgatatc
gatcttgagtatgttaaccagatgaatgaactgcgccttagcgctctgcgggtgcagcaa
atggtgatgaatctggggctggagcagatccagaaaaatgcaccaacgctggaaaagcag
ctcaataatgcggtgaaaattctgcaacgtcggcaaatacgcattgaagatccgggagtt
cgtgcgcaggtcgcaacaacgttaactaccgttagccaatatagcgatctgttggcgctg
ttccagcaggacagtgaaatcagcaatcacctgcaaactctcgcccaaaataatatcgcc
cagttcgcgcagtttagtagcgaagtcagtcagctggtcgacaccattgagctgcacaat
cagcatggactggcacatctggaaaaagccagtgcacgcgggcaatacagcctgttattg
ctggggatggtttcactttgcgcactgattatgatcctctggcgcgtggtttatcgctca
ttcacgcgtccacttgccgaacaaacgcaggcgctgcaacggctgctggacggtgatatt
gactcccctttcccggaaaccgctggcgtacgggagctggataccatcgggcggctgatg
gatgcgtttcgcagcagtgttcatgcactgaatcgccaccgcgaacagctggcggcgcag
gtcaaagcgcgtacagctgaattgcaggaactggtgatagaacaccgacaggcacgggcg
gaagcagaaaaagccagccaggcaaaatcggcgtttctgacggcgatgagccatgagatc
cgcacaccgctgtacggtattctcggcactgctcaactgctggcagataaccccgcactt
aacgcccagcgtgatgatttgcaggcgattaccgactctggcgaatcgttgctgaccatc
ctcaacgatattctcgattattcggctatcgaagcaggtggcaaaaatgtttcagtcagc
gatgagccctttgaaccgcgcccgctgctggaaagtaccctgcaattaatgagcggacgg
gtgaaaggtcgcccgattcgcctggcaacggcaattgccgatgatgtaccgagcgcgtta
atgggcgatccacgacgtattcgtcaggtcattaccaacctattgagcaatgccctgcgt
tttactgacgaagggcacattatcctgcgtagtcgcactgatggcgagcaatggctggtc
gaagtggaagacagcggctgcggtattgatcccgcgaaactggcagaaatcttccagcca
tttgtgcaggtaagcggcaaacgcggcggcaccgggctggggctgactatcagtagccgt
ctggcccaggcgatgggcggcgaactgagcgccaccagcacgccggaggttggaagctgt
ttttgtttacgcttgccgttacgtgttgccactgcacccgtgccaaaaacagccaatcag
gcggtgcgtcttgacggtttacgtttgctgttaattgaagataacccgctaacccagcga
attaccgttgagatgctgaacaccagtggtgcgcaggttgttgctattggcaatgccgcg
caggctttagagacactgcaaaatagcgaaccgtttgctgccgcactggtggattttgat
ctgccggatatcgacggcattacccttgcccggcaactggcacagcaatatccgtcgctg
gttttgattggctttagcgcccatgtcattgacgaaacgctgcgccagcgtaccagttca
ctatttcgcgggattatccctaaaccggtgccgcgtgaagtgctcggtcagttactggcg
cactatctccaactgcaagccaataacgatctaccactggatgtctcgcaactcaatgaa
gacgctcagttaatggggacggagaagatccacgaatggctggcattatttaaacaacat
gccctgccgcttctcgatgaaatcgacattgcccgcgccagccaggacagcgagaaaata
aagcgtgccgcgcatcagctaaaaagcagttgctcgagtctgggaatgcgtagcgccagt
cagctatgcgcacaactggagcagcagccattatctgccccccttccacacgaagaaatt
acacgcagtgttgccgctctggaagcatga

DBGET integrated database retrieval system