KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_01044Help
Entry
NCTC1_01044       CDS       T03751                                 

Gene name
agp
Definition
(GenBank) glucose-1-phosphatase/inositol phosphatase,Glucose-1-phosphatase precursor,glucose-1-phosphatase/inositol phosphatase,Histidine phosphatase superfamily (branch 2)
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00010  Glycolysis / Gluconeogenesis
sft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCTC1_01044 (agp)
Enzymes [BR:sft01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     NCTC1_01044 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: CDX06290
UniProt: A0A380B3I1 A0A384LET7
Position
1:1013669..1014910
Genome map
AA seq 413 aa AA seqDB search
MNKTLIAATVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGIVKSGECPPPDTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPMITDDSAAFSEQAVAAMEKELSKLQLTDS
YQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRA
SAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIE
YVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDANGFCPMDKFDSVLNEAVK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgctaatcgccgcaactgtggcagggatagttttactcgcttcaaatgct
caggcacaaaccgtaccggaaggctatcagctacagcaagtgctcatgatgagccgccat
aacttacgtgcgccgctggcgaacaatggcagtgtgctggagcagtcgacgccgaataaa
tggcccgaatgggacgtccccggtgggcaactcaccaccaaaggtggcgtgctcgaagtg
tatatgggccattacatgcgtgaatggctggcagagcaggggatagtgaaatcgggggaa
tgcccgccgccggacaccgtttatgcctatgccaatagtctgcaacgtaccgtcgctacc
gcccagttctttattactggtgcattccctgggtgtgatattcctgtgcatcaccaggaa
aaaatgggcactatggacccaacctttaacccgatgatcaccgatgattccgccgcattc
agtgaacaggcggtggcggcaatggagaaagagctcagcaaactccagcttaccgacagc
taccagctactggaaaaaatcgttaactataaagattcccctgcctgtaaagagaaacaa
cagtgttcgctggtggatggcaaaaatacctttagcgccaagtatcaacaagaaccaggt
gtttccgggccgctgaaagtcggcaactcgctggtagatgcgtttactttgcaatactac
gaaggttttccgatggatcaggtggcctggggagaaatcaaatctgaccagcagtggaag
gtattgtcgaagctgaaaaacggttaccaggacagtctgtttacctcaccggaagtggcg
cgcaatgttgcgaaaccgctggtcagttatatcgacaaagccctggtcaccgatcgcgcc
agtgctccgaaaatcacggtgttagttgggcacgactccaacatagcctctctgttaacg
gcgctggatttcaaaccgtatcagttgcatgaccagaacgaacgcacgccgattggcggc
aaaatcgttttccagcgttggcatgacagcaaagccaatcgcgatttgatgaaaattgaa
tatgtgtaccagagtgcggaacagttacgtaatgccgatgcgttaaccctgcaggcacct
gcgcagcgcgtgacgctggaattaagcggttgcccgatagatgccaacggtttctgcccg
atggataagtttgatagcgtgttgaatgaggcggtgaaataa

DBGET integrated database retrieval system