KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_01933Help
Entry
NCTC1_01933       CDS       T03751                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A,Lactaldehyde dehydrogenase,aldehyde dehydrogenase A,Delta 1-pyrroline-5-carboxylate dehydrogenase,succinate-semialdehyde dehydrogenase,Aldehyde dehydrogenase family
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00620  Pyruvate metabolism
sft00630  Glyoxylate and dicarboxylate metabolism
sft01100  Metabolic pathways
sft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC1_01933 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC1_01933 (aldA)
Enzymes [BR:sft01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     NCTC1_01933 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     NCTC1_01933 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF2800
Motif
Other DBs
NCBI-ProteinID: CDX07141
UniProt: A0A380A7T9
Position
1:complement(1788924..1790363)
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLCKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQ
FVNLLGEALQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggctgtcatttcccgcatacccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgctattgaacgcgccagttggttgtgcaaaatctccgccgggatccgc
gaacgcgccagtgaaatcagtgcgctgattgttgaagaagggggcaagatccagcagcta
gctgaagtcgaagtggcttttactgccgactatatcgattacatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccgggagaaaatattcttctgtttaaa
cgtgcgcttggtgtgactaccggcattctgccgtggaactttccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgaccggtaataccatcgtcattaaacccagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgtcgatgaaataggccttccgcgcggc
gtgtttaaccttgtactggggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgagaagatcatggcgact
gcggcgaaaaacatcaccaaagtgtgtctggaattgggtggtaaagcaccggctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaggcatttatgatcag
ttcgtcaatctgctgggtgaagcgttgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatggggccgttgattaacgccgcggcgctggaaagggttgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggtgctgccagttgtcgcatttgacacgctggaagatgct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggtttccacgccggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcctgcatgaatatctgcagacccaggtggtttatttacagtcttaa

DBGET integrated database retrieval system