KEGG   Shigella flexneri NCTC1: NCTC1_03142Help
Entry
NCTC1_03142       CDS       T03751                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase,Acetyl-CoA acetyltransferase,acetyl-CoA acetyltransferase,Transcription-associated recombination protein,acetyl-CoA C-acetyltransferase,Thiolase, N-terminal domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sft  Shigella flexneri NCTC1
Pathway
sft00071  Fatty acid degradation
sft00280  Valine, leucine and isoleucine degradation
sft00310  Lysine degradation
sft00362  Benzoate degradation
sft00380  Tryptophan metabolism
sft00620  Pyruvate metabolism
sft00630  Glyoxylate and dicarboxylate metabolism
sft00640  Propanoate metabolism
sft00650  Butanoate metabolism
sft00900  Terpenoid backbone biosynthesis
sft01100  Metabolic pathways
sft01110  Biosynthesis of secondary metabolites
sft01120  Microbial metabolism in diverse environments
sft01130  Biosynthesis of antibiotics
sft01200  Carbon metabolism
sft01212  Fatty acid metabolism
sft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC1_03142 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC1_03142 (thlA)
   00640 Propanoate metabolism
    NCTC1_03142 (thlA)
   00650 Butanoate metabolism
    NCTC1_03142 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCTC1_03142 (thlA)
   00072 Synthesis and degradation of ketone bodies
    NCTC1_03142 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCTC1_03142 (thlA)
   00310 Lysine degradation
    NCTC1_03142 (thlA)
   00380 Tryptophan metabolism
    NCTC1_03142 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCTC1_03142 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCTC1_03142 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC1_03142 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sft04147]
    NCTC1_03142 (thlA)
Enzymes [BR:sft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCTC1_03142 (thlA)
Exosome [BR:sft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCTC1_03142 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: CDX08279
UniProt: A0A0H2V1J1 Q83JV6
Position
1:complement(2907560..2908741)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system