KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_03157
Entry
NCTC1_03157       CDS       T03751                                 

Gene name
ndhS
Definition
(GenBank) xanthine dehydrogenase subunit XdhC,Nicotinate dehydrogenase small FeS subunit,xanthine dehydrogenase subunit XdhC,Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs,xanthine dehydrogenase E subunit,[2Fe-2S] binding domain
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00230  Purine metabolism
sft01100  Metabolic pathways
sft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCTC1_03157 (ndhS)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CDX08293
UniProt: A0A3T6J7Z8
Position
1:2923689..2924168
AA seq 159 aa
MNHSETITTECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGTVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccaccgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcaca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system