KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_03627Help
Entry
NCTC1_03627       CDS       T03751                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22,50S ribosomal protein L22,50S ribosomal protein L22,ribosomal protein L22,Ribosomal protein L22p/L17e
  KO
K02890  large subunit ribosomal protein L22
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sft00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NCTC1_03627 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sft03011]
    NCTC1_03627 (rplV)
Ribosome [BR:sft03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NCTC1_03627 (rplV)
  Bacteria
    NCTC1_03627 (rplV)
  Archaea
    NCTC1_03627 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Mic1 Peptidase_U40
Motif
Other DBs
NCBI-ProteinID: CDX08739
UniProt: A0A2S4N174
Position
1:complement(3348585..3348917)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVQVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggctctggatattttgacctacaccaac
aagaaagcggctgtacaggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttacgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system