KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_04432Help
Entry
NCTC1_04432       CDS       T03751                                 

Gene name
aceB_1
Definition
(GenBank) malate synthase,Malate synthase A,malate synthase,Isocitrate lyase,malate synthase A,Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00620  Pyruvate metabolism
sft00630  Glyoxylate and dicarboxylate metabolism
sft01100  Metabolic pathways
sft01110  Biosynthesis of secondary metabolites
sft01120  Microbial metabolism in diverse environments
sft01200  Carbon metabolism
Module
sft_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC1_04432 (aceB_1)
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC1_04432 (aceB_1)
Enzymes [BR:sft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCTC1_04432 (aceB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Prophage_tail
Motif
Other DBs
NCBI-ProteinID: CDX09500
UniProt: A0A2Y4ZHP3
Position
1:4150587..4151243
Genome map
AA seq 218 aa AA seqDB search
MTEQATTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRDADWKIRGIPADLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcacaaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaacgttgcctgattttatttcggaaacggcttccattcgcgatgctgattggaaaatt
cgcgggattcctgcggacttagaagaccgccgcgtagagataactggcccggtagagcgc
aagatggtgatcaacgcactgaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggcaccagactggaacaaagtgatcgacgggcaaattaacctgcgcgatgcggtt
aacggtaccatcagctataccaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatctgccgaaaacccagtcctag

DBGET integrated database retrieval system