KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_04447Help
Entry
NCTC1_04447       CDS       T03751                                 

Gene name
sorB
Definition
(GenBank) PTS system sorbose transporter subunit IIB,Sorbose-specific phosphotransferase enzyme IIB component,PTS system mannose-specific transporter subunits IIAB,Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIB,PTS system, mannose/fructose/sorbose family, IIB component,PTS system sorbose subfamily IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00051  Fructose and mannose metabolism
sft01100  Metabolic pathways
sft02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCTC1_04447 (sorB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    NCTC1_04447 (sorB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sft02000]
    NCTC1_04447 (sorB)
Enzymes [BR:sft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     NCTC1_04447 (sorB)
Transporters [BR:sft02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    NCTC1_04447 (sorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: CDX09515
UniProt: A0A379YMY7 A0A384LBR9
Position
1:complement(4168576..4169070)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgtctgatccacggccaggtcactaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagtgcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaataggc
accctgaatattggcggcatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatcttggtgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system