KEGG   Syntrophobacter fumaroxidans: Sfum_0368Help
Entry
Sfum_0368         CDS       T00418                                 

Definition
(GenBank) L-aspartate 1-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00410  beta-Alanine metabolism
sfu00770  Pantothenate and CoA biosynthesis
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
Module
sfu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfum_0368
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sfum_0368
Enzymes [BR:sfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Sfum_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_decarbox
Motif
Other DBs
NCBI-ProteinID: ABK16068
UniProt: A0LF66
Position
complement(440423..440797)
Genome map
AA seq 124 aa AA seqDB search
MQRLMLKSKIHRARVTEANLHYEGSLTIDETLMKAADILPYEQIKVYNVFNGARFDTYAI
AGPAGSGVFCLNGAAARMGAAGDLIIIATYAQYDEAEIARHQPKVVLLDGDNRPLSQGLK
ACLS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagactgatgcttaaatccaaaatccaccgcgcgcgggtcaccgaagcaaacctt
cactatgaaggaagcctgaccatagacgaaaccctgatgaaggcagccgatattctgccc
tacgagcagatcaaggtttacaacgtcttcaacggcgccaggttcgacacgtacgccatc
gccggccccgcgggcagcggcgtgttttgtctcaacggcgcggctgccaggatgggagcc
gccggggatctgatcatcatcgcaacgtacgcgcaatacgacgaagccgaaatcgcgcgt
catcaaccgaaggtcgtcctgctcgacggagacaaccggcctctgtcgcagggattgaaa
gcgtgcttgagttga

DBGET integrated database retrieval system