KEGG   Syntrophobacter fumaroxidans: Sfum_0691Help
Entry
Sfum_0691         CDS       T00418                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sfum_0691
Enzymes [BR:sfu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Sfum_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABK16390
UniProt: A0LG38
Position
complement(840079..840777)
Genome map
AA seq 232 aa AA seqDB search
MEHAILVIATRNKGKSREIGKYLEHFPVEVRDLNDFGPIPEVVEDGATFEENAYKKALLT
ARVLGLPALADDSGLEVAALGGAPGIHSARYAGPDASDAANNEKLLAALSGVEDRAARFC
CVLSLAVPSGPALTYEAFCEGTILTAPRGDNGFGYDPLFHYAPAGKTFAEMSLDEKAKVS
HRGRALLELQREFDQVLKWLHARTADENLRRGVGHDMCVTGEDPRGTEPKME
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgccatactcgtcatcgcgaccaggaacaagggaaaatcgagggagatcggg
aaatacctcgaacattttcccgtggaagtcagggatctgaatgatttcggtcccattccc
gaagtggtcgaggacggtgcgactttcgaggaaaacgcgtacaagaaggctctgttgacg
gccagagtcctcggcctgccggcgctcgccgatgattccgggctggaagtcgcggccctg
ggcggagcgcccggtatccattccgcccggtatgccggtcccgacgcgtcggatgccgcc
aacaacgagaaactgctggcggccctttcgggagtggaagaccgggcagcccggttttgc
tgcgtcctttccctggcggtgccgtccggtcccgcccttacttatgaggccttttgcgag
ggcactatcctgaccgctccgagaggggataacggtttcggctacgacccgcttttccac
tatgcgccggccgggaagaccttcgcggagatgagcctcgacgaaaaggccaaggtcagc
catcgcggccgcgcactgcttgaattgcagcgcgaattcgaccaggtgctcaagtggttg
catgccaggaccgccgacgagaatctgcgccgcggcgtgggacatgacatgtgtgtcacg
ggggaagacccccggggcacggagccgaagatggagtga

DBGET integrated database retrieval system