KEGG   Syntrophobacter fumaroxidans: Sfum_0829Help
Entry
Sfum_0829         CDS       T00418                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00071  Fatty acid degradation
sfu00350  Tyrosine metabolism
sfu00625  Chloroalkane and chloroalkene degradation
sfu00626  Naphthalene degradation
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0829
  Lipid metabolism
   00071 Fatty acid degradation
    Sfum_0829
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sfum_0829
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfum_0829
   00626 Naphthalene degradation
    Sfum_0829
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sfum_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABK16526
UniProt: A0LGH4
Position
complement(1028166..1029164)
Genome map
AA seq 332 aa AA seqDB search
MRAMVLKACAPMETKPLEWLEVDDPLPGPGEVRIRVKACGICRTDLHVVEGELPSLGRPV
IPGHQIVGLVDSIGTGCRRFKIDDRIGAAWLRQTCGTCVFCRSGQENLCENARFTGYHAP
GGYAEYAVVPEDFAYPIAPVFSDAEAAPLLCAGIIGYRSLRRSQCKAGDTLALYGFGSSA
HIVIQIAVHWGCTVYAVTRGERHRRLALELGAKWAGSDAERLPAPADSAIIFAPAGNLVP
VALSRLRKGGTLALAGIYMTDIPGMNYEKHLFYEKNVHSVTANTREDGMELLRIAASIPI
RPQVQTFAVQEANEALLKLKNDRIEGSGVLVF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatggttctgaaggcgtgtgccccgatggaaacgaagcccctcgaatggctg
gaggtggatgatccactgcccggccccggggaagtgcgcatcagggtgaaagcgtgcggc
atatgcaggaccgacctgcacgtggtggagggggaattgccttccctcgggcgtcccgtc
attccgggccaccagatcgtcggcctggtggattccatcggaaccggctgtcggcggttc
aagatcgatgacagaatcggggcggcatggttgagacagacctgtggaacatgcgtcttc
tgccgctccgggcaggagaatctgtgtgaaaacgccagattcaccggctatcatgcccct
ggcgggtacgccgaatatgccgtggtcccggaagatttcgcctatcccattgcgcccgtc
ttcagcgacgcggaagccgcaccgctgctgtgcgccggcattatcggttaccggagcctg
aggcgcagccagtgcaaagccggcgacaccctggccctgtacggattcggttcgtcggcg
cacatcgtcattcagatcgccgtccactggggttgcacggtgtatgccgtcacccgcggc
gagagacatcggcggctggcactggagctcggggccaaatgggccggatccgacgcggaa
cggctgcccgccccggcggacagcgccatcatcttcgcccccgcgggaaacctcgtgccc
gtggcgctgagccgtttgcgcaagggcggtacgctggcccttgccgggatctatatgacc
gacattcccgggatgaattacgagaagcaccttttctacgaaaaaaacgttcacagcgtc
acggccaatacgcgggaagacggcatggagctgctcaggatcgccgcgtccatacccatt
cgcccgcaggtgcaaacgtttgccgtgcaggaagccaacgaagcgctgctcaagctcaag
aatgaccggattgagggctcgggggtgctggtattctga

DBGET integrated database retrieval system