KEGG   Syntrophobacter fumaroxidans: Sfum_1035
Entry
Sfum_1035         CDS       T00418                                 

Definition
(GenBank) GrpE protein
  KO
K03687  molecular chaperone GrpE
Organism
sfu  Syntrophobacter fumaroxidans
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sfu03110]
    Sfum_1035
   03029 Mitochondrial biogenesis [BR:sfu03029]
    Sfum_1035
Chaperones and folding catalysts [BR:sfu03110]
 Heat shock proteins
  HSP24
   Sfum_1035
Mitochondrial biogenesis [BR:sfu03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    Sfum_1035
SSDB
Motif
Pfam: GrpE
Other DBs
NCBI-ProteinID: ABK16729
UniProt: A0LH27
Position
1278461..1279030
AA seq 189 aa
MSKKHMKGNGGEVPENSEMSGSEELVAVEPGEPDYRELLARKEEELKQSQDRLLRMAAEL
DNTRKRLEREKSEGIAYANEGLMKDLLPVLDNLERALEHSENEADCGSLVEGVRMTLKGF
LDSLARFGCTPFESVGNAFDPNFHEAVMQEEVADYPERTVIREFQKGYTLKERLLRPAMV
VVSKAAGDT
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtccaaaaaacatatgaagggaaacggcggtgaggttcccgagaactcggagatgagc
gggagcgaggaactggtcgccgttgagcccggggaacccgactacagggagttgctggcg
cgcaaagaggaagagctcaagcagtcccaggaccgcctgttgcgcatggcggcggaattg
gacaacaccaggaaacggctcgaacgggagaaatccgaagggatcgcctacgccaacgaa
ggcctcatgaaggacctgcttcccgtgctcgacaacctcgagcgcgccctggagcacagc
gagaacgaggcggactgcgggagcctggtggagggagtgcgcatgacgttgaagggcttt
ctggacagcctggcccggttcggatgcacgccgttcgagtcggtgggcaacgctttcgat
cccaacttccatgaagccgtgatgcaggaggaagtcgccgactatcccgaacgcacggtg
atacgggaattccagaaaggttacacgctcaaggaacggctgctgcgtcccgccatggtg
gtggtgtcgaaagccgccggtgacacgtag

DBGET integrated database retrieval system