KEGG   Syntrophobacter fumaroxidans: Sfum_1941Help
Entry
Sfum_1941         CDS       T00418                                 

Definition
(GenBank) respiratory-chain NADH dehydrogenase, subunit 1
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00190  Oxidative phosphorylation
sfu01100  Metabolic pathways
Module
sfu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sfum_1941
Enzymes [BR:sfu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Sfum_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh
Motif
Other DBs
NCBI-ProteinID: ABK17626
UniProt: A0LJM4
Position
complement(2369011..2370006)
Genome map
AA seq 331 aa AA seqDB search
MLNWTAGFLVLIAKLTIVLAVLLLVAAYLVWLERKFLARLQIRYGPNRAGKFGLLQPIAD
IVKMVAKEDTVPEGAERTIFMLAPAVVAATALLVFAVIPFGKDVTLWGMKIPLVVADLNV
GLLYFFALSSLGVYGVALGGWASNSKYSLLGGIRGAAQMISYELSLGLAIVPVVMQARSF
SLVDIVQAQEKYPFILTQPVAFAIFVISAMAEIKRIPFDLPEAENELGAGFHTEYSGMRF
GLFFLGEYVNMQVLGGLVAVLFLGGWHGPLLPPVVWLFIKIVLVALIMIWVRGTLPRLRY
DQLMALGWKVLIPLALVNIMVTGAWVLWMGK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactggacggcgggttttcttgttttgatcgccaagctgacgatcgtgctggcg
gtattgctcctcgtggccgcctacctcgtgtggctcgagcgcaaattcctggcgcggctc
cagatccgctacggacccaaccgggcgggaaaattcggcctgcttcagcccatcgccgac
atcgtcaagatggtcgccaaggaagacaccgtgcccgagggggcggagagaaccattttc
atgctggctccggcggtggttgccgccacggcgctgctcgtgttcgccgtgattcccttc
gggaaggacgtgacgctgtggggcatgaagataccgctcgtggtggccgacctcaacgtc
ggcctgctctacttcttcgcgctgtcgtccctgggagtctacggagtcgccctcggcggc
tgggcttccaattccaagtacagccttctgggggggataaggggcgcggcccagatgatc
agctatgagctgtccctgggactggccatcgtgccggtcgtcatgcaggcacgttctttc
agcctggtggatatcgttcaagcccaggagaagtacccgttcatcctgacgcagccggtc
gctttcgcgattttcgtgatcagcgcgatggcggagatcaaacggattccgttcgacctg
cccgaagctgagaacgagctgggcgccggcttccacacggaatacagcgggatgcgtttc
gggctcttctttctcggagagtacgtcaacatgcaggtgttgggcggcctcgtcgcggtg
cttttcctcgggggctggcacgggccgcttctgccgcccgttgtctggctgttcatcaag
atcgtcctggtggcgctgatcatgatctgggtgcgaggcacactgccccggctgcgctac
gatcaattgatggcgctcggctggaaggtcctgatccctctcgccctggtcaacatcatg
gtgacgggagcctgggtactgtggatggggaagtga

DBGET integrated database retrieval system