KEGG   Syntrophobacter fumaroxidans: Sfum_2275Help
Entry
Sfum_2275         CDS       T00418                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sfu  Syntrophobacter fumaroxidans
Brite
KEGG Orthology (KO) [BR:sfu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Sfum_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABK17957
UniProt: A0LKK5
Position
2796462..2797475
Genome map
AA seq 337 aa AA seqDB search
MHDQLIILILVIVVSLIFDYTNGAHDSANAIATVVSTKVLSPRTAVLMAAVLNFVGALAG
TKVAHTIGSGIVRPEMITGSQGIVLAALSGAIAWNLLTWYLGLPSSSSHALIGGLVGAAV
THGGWDSLNYWNIFYKVILPLFLSPMAGMIGGYVLMVSLAWLCFRSHPRKCNSTFRRLQV
LSSAFMATSHGLNDAQKTMGIMTLALFLFHQVPVLEIPLWVKLSCAVAMALGTATGGWRI
VKTMGHKIFKLEAVHGFAAETAAALVITAASTVGAPISTTHTISSSVLGVGASKRLSAVR
WGIAGHMVIAWILTLPAAALVAGFFLHCFHLLGLVTY
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatcaactgatcatattgatcctggtcatcgtggtctcgttgatcttcgattac
accaacggcgcacacgacagcgccaacgccatcgccacggtggtgtcgaccaaggtcctg
tcccccagaaccgccgtgctcatggccgccgtactgaacttcgtcggagcgctggccggc
accaaggtcgctcacaccatcggcagcggaatcgtgcgcccggagatgatcaccgggtcg
cagggaatcgttctggccgcactgtccggagcgatcgcctggaacctgctgacctggtac
ctcgggctgccctcgtcatcctcccatgcgctcatcggcgggctcgtgggggcggcggtc
acgcacggcggctgggactccctcaattactggaatatattctataaagtgattcttccc
ctattcctgtcccccatggccggcatgatcggcggttacgttctcatggtgtcgctggcg
tggctgtgtttcaggtcccatccgcgcaaatgcaacagtacctttcgaaggctccaggtg
ctttcttcggcttttatggctacgagccacggtctgaacgatgctcagaagaccatggga
atcatgaccctggccctgttcctcttccaccaggtacccgtcctggagattcctctctgg
gtaaagctgtcctgcgccgtggccatggccctgggaaccgccacaggcggatggaggatc
gtgaagacgatgggccacaaaattttcaaactggaagccgttcacggttttgcggcggaa
accgccgccgccctggtcatcaccgcggcttccaccgtgggcgcccccatcagcaccact
cacaccatttcgtcctccgtgctgggagtgggggcttccaagcggctttccgcagtccgg
tggggcattgccgggcacatggtgatcgcctggattctcacgctcccggccgccgctctt
gttgccggtttcttcctccattgcttccacctgctcggtcttgtcacctattag

DBGET integrated database retrieval system