KEGG   Syntrophobacter fumaroxidans: Sfum_2404Help
Entry
Sfum_2404         CDS       T00418                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00260  Glycine, serine and threonine metabolism
sfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01130  Biosynthesis of antibiotics
sfu01230  Biosynthesis of amino acids
Module
sfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_2404
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfum_2404
Enzymes [BR:sfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfum_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK18085
UniProt: A0LKY3
Position
2969421..2970782
Genome map
AA seq 453 aa AA seqDB search
MEQVKVILADNEIPRQWYNILPDMPTPMHPPLHPGTGKPVEPQDLAAVFPMNLIEQEVST
QSWIDIPEAVLEKYLLWRPTPLCRARNFEKLLDAPVKIYYKNEGVSAPGSHKPNTAIPQA
YYNKVFGIRRISTETGAGQWGSALSMACRMFGLQCRVFMVRISYDQKPYRRMMMSTWGAE
CIPSPSDFTRAGRRILSDDPESPGSLGIAISEAIEDAVGDENARYSLGSVLNHVLLHQTI
IGLEAHRQFEKIGEYPDVVMGCAGGGSNFAGLSLPFVRDKIHGREVSIIAAEPASCPTLT
RGPFAYDFGDTAMTTPLLPMYTLGHGFIPASIHAGGLRYHGMAPIVSHLVKEGIVQAQAY
DQIETFTAGLKWAQSEGFIPAPETNHVIAAVVREAELARQEGKEKVILFNWSGHGIIDLP
AYDAFLSGKLTQHALTDEEIREALKSIEGYPKP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggtgaaggtgattctggccgacaacgaaatccccaggcaatggtacaacata
ctccccgatatgccgactccgatgcatccgccgctgcatccgggaacgggaaaaccggtg
gaaccgcaggacctggccgctgtctttcccatgaacctgatcgagcaggaggtttccacc
caaagttggatcgatattcccgaagcggtcctggaaaagtatctcctgtggcgacccact
ccgctctgtcgtgcccgcaatttcgagaagctgctcgacgctccggtgaagatctactac
aagaacgaaggggtgagcgcgcccggctcccacaaacccaacacggccattccgcaagct
tactacaacaaggtgttcggcatccggcggatttccaccgagaccggggccgggcagtgg
ggcagtgccctcagcatggcgtgccggatgttcggcctgcaatgcagggtcttcatggtc
aggatcagctacgaccagaaaccgtaccggcgcatgatgatgtccacgtggggggccgag
tgcattccaagccccagcgacttcacgcgtgcggggaggagaatcctgtccgacgatccc
gagtcgccggggagcctgggcatcgccatcagcgaagccatcgaggacgccgtcggggac
gaaaacgcccggtactccctgggaagcgttttgaatcacgtgctgctgcaccagaccatc
atcggcctggaagcccaccgacagttcgaaaagatcggcgaataccccgacgtggtgatg
ggctgtgcgggaggaggaagcaacttcgccggactgtccctgcccttcgttcgggacaag
attcatggcagggaggtttccatcatcgccgcggagcccgcgtcctgcccgaccctgacg
cgcggaccgttcgcctacgatttcggcgacaccgccatgacgacgccgctcctgcccatg
tataccctggggcacggcttcataccggcctccatccacgccggcgggctccggtaccac
ggcatggccccgatcgtcagccacctggtcaaggaaggaatcgtccaggcccaggcctac
gaccagatcgaaaccttcaccgccggcctgaaatgggcccagtccgaggggttcattccc
gctcccgaaaccaaccacgtcatcgcggcggtggtccgtgaagcggagctcgcccggcag
gaaggcaaggagaaggtcatcctcttcaactggagcggccacgggatcatcgatcttccg
gcctatgacgctttcctctccgggaagctcacccagcacgcgttgaccgacgaggagatc
cgggaagccctgaaatccatcgaaggatatccaaaaccgtag

DBGET integrated database retrieval system