KEGG   Syntrophobacter fumaroxidans: Sfum_2794Help
Entry
Sfum_2794         CDS       T00418                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00020  Citrate cycle (TCA cycle)
sfu00620  Pyruvate metabolism
sfu00633  Nitrotoluene degradation
sfu00640  Propanoate metabolism
sfu00650  Butanoate metabolism
sfu00680  Methane metabolism
sfu01100  Metabolic pathways
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_2794
   00020 Citrate cycle (TCA cycle)
    Sfum_2794
   00620 Pyruvate metabolism
    Sfum_2794
   00640 Propanoate metabolism
    Sfum_2794
   00650 Butanoate metabolism
    Sfum_2794
  Energy metabolism
   00680 Methane metabolism
    Sfum_2794
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sfum_2794
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sfum_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABK18472
UniProt: A0LM20
Position
3443008..3444189
Genome map
AA seq 393 aa AA seqDB search
MSKKIGVEVSIAAADAVGLCDVDVVAAYPITPQTHIVEHLSELVAEGHLDAEFVPVESEH
SAMSACIGSSAAGARTFTSTCSQGYALMSELCYIASALRLPIVMAVANRAISAPINIWND
HGDLMYARDSGWIQVIGENGQETVDLTIAAFRIAEDPNILLPVQVNLDGFTLSHMIEPIV
MPDKKDVKKFLPAYKPQLRLDPANPITMGPVGMPDVYTEARKAQDEALKSSKAQIVKIFN
EFGKQFGRKYNLVETYKTEDAETIIITMGSLSQTAMTAVDMMRDKGKKVGVARIRVFRPF
PADELFAAIKGAKNLVILDRVTSFTGGYVSGPVCLEIKSILYDRKHYPKIGNFLAGLGGR
DTTDQNFMEMVDKVAASKDGGVPLAYEFINVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagattggtgtagaagtttcaattgcagctgcggatgcggtaggactgtgt
gatgtcgacgtcgtcgccgcatacccgatcacgccgcagacccacattgtcgaacacctg
tcggagctggttgccgaaggtcatctggatgccgagttcgttcccgtggaatccgagcac
agcgccatgagcgcctgcatcggttcgtccgcggccggagcgcgcaccttcacgtccacc
tgctcgcagggttatgccctgatgtcggagctttgctacatcgcctccgcccttcgtctt
cccatcgtcatggcggtcgccaaccgcgccatcagcgctccgatcaacatctggaacgac
cacggcgacttgatgtacgccagggattcgggctggatccaggtcatcggggagaacggc
caggaaacggtggaccttacgatcgccgctttccgcatcgccgaggatcccaatatcctg
ctgccggtgcaggttaacctggacgggttcaccctgagtcacatgatcgagccgatcgtg
atgcccgacaagaaggacgtgaaaaagttcctgcctgcgtacaagcctcagctgcggctg
gatcccgccaacccgatcaccatgggtccggtcggcatgcccgacgtgtacaccgaggcg
cggaaggcccaggacgaggcgctgaagagctccaaggcccagatcgtgaagatcttcaac
gaattcggcaagcagttcggtcggaaatacaacctggttgaaacctacaagaccgaagat
gccgagaccatcatcatcaccatgggcagcctttcccagaccgcgatgaccgccgtcgac
atgatgagggacaaggggaagaaggtcggcgtggcccgcatccgggtgttccggccgttc
cccgccgatgaattgtttgcggccatcaagggcgccaagaacctggtcattctggacagg
gtcacctcttttacgggtggctacgtctccggcccggtgtgcctggaaatcaagtccatt
ctctacgaccgcaagcactatccgaagatcggcaatttcctggccggcctcggcggcaga
gacacgacggatcagaacttcatggaaatggtcgacaaggttgccgcgtccaaagacggt
ggcgtgcccttagcctacgaattcatcaatgtgagggaataa

DBGET integrated database retrieval system