KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0048Help
Entry
SFV_0048          CDS       T00377                                 

Gene name
imp
Definition
(GenBank) organic solvent tolerance
  KO
K04744  LPS-assembly protein
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfv02000]
    SFV_0048 (imp)
Transporters [BR:sfv02000]
 Other Transporters
  Pores ion channels [TC:1]
   SFV_0048 (imp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptD OstA
Motif
Other DBs
NCBI-ProteinID: ABF02335
UniProt: Q0T8E1
Structure
PDB: 

Position
complement(53741..56095)
Genome map
AA seq 784 aa AA seqDB search
MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAK
GDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILK
GPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTW
SVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNY
FEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYED
EHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFS
VGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNT
RDDMPEATRVHLEPTINLPLSNNWGSINTEAKFLATHYQQTNLDWYNSRNTTKLDESVNR
VMPQFKVDGKMVFERDIEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGL
FRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWEND
DKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYHYAS
PEYIQATLPKYYSTAEQYKNGISQVGAVASRPIADRWSIVGAYYYDTNANKQADSMLGVQ
YSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPY
QNTL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtatccccactctcctggccaccatgattgccaccgccctttatagtcaa
cagggactggcagccgacctcgcctcacagtgcatgttgggcgtgccaagctatgaccgt
cctctggtacagggcgataccaatgacttacccgtgactatcaatgctgaccacgcgaaa
ggggactacccggatgacgccgtgtttactggcagcgtggatatcatgcagggtaacagc
cgtctgcaggccgacgaagtgcagctccatcaaaaagaggcaccaggacaaccggagccg
gtacgtaccgttgatgcgctcggtaatgtccattacgacgataaccaggtgatcctcaaa
gggccgaaaggctgggcgaatctgaacaccaaagataccaacgtctgggaaggtgattac
cagatggtgggtcgccagggtcgcggtaaagcggacctgatgaaacaacgtggcgaaaac
cgctataccattctggataacggtagctttacctcctgtctgccgggttctgacacctgg
agcgtggtaggtagcgaaattattcatgaccgcgaagaacaagttgcggagatctggaac
gcccgctttaaggtgggtccggtaccgatcttttatagcccctatttgcagttgccggtg
ggtgacaaacgtcgctctggtttcttgatcccgaacgccaagtacaccaccaccaactac
tttgagttctacctgccatattactggaacatcgcgccaaatatggatgccaccatcacg
ccgcattatatgcatcgtcgtggcaacatcatgtgggagaacgaattccgctacctctcc
caggcgggcgctggcttgatggaactggactatctgccttcagataaagtctatgaagat
gaacacccgaacgatgacagttcacgtcgttggttattctactggaaccactccggggtc
atggatcaggtgtggcgtttcaacgtcgactacaccaaggtcagcgatcctagctacttc
aatgatttcgataacaagtacggttccagtactgacggctacgcaacgcaaaaattcagc
gttggctatgcggtgcaaaacttcaatgccaccgtttcaaccaagcagttccaggttttc
agcgaacagaacaccagtagctactcggcagagccgcagttagacgttaattactaccag
aatgatgttggtccgtttgatacgcgtatttacggccaggcagtgcactttgttaacacc
agagacgacatgcctgaagcaacccgtgttcacctggaaccgaccatcaatttgccgctc
tctaataactggggcagcatcaataccgaagcgaagtttctggcaacccattatcagcaa
accaatcttgactggtataactccagaaacacgaccaagctggacgaatccgttaaccgc
gtaatgccgcaattcaaagttgacggcaaaatggtctttgaacgcgatatagaaatgctg
gctccgggttatacccaaacgctggaaccgcgcgcgcagtatttgtacgtgccgtatcgc
gatcagagcgacatctataactacgactcgtctctgctgcaatctgactactctggcctg
ttccgggaccggacttacggcggtcttgaccgtattgcctccgctaaccaggtgacgacc
ggtgtcacatctcgcatatatgatgatgctgccgttgaacgttttaatatttccgttggt
caaatctactatttcacggagtctcgcactggcgatgacaacataacatgggagaatgac
gacaaaacgggctcactggtgtgggcaggcgacacctactggcgtatctccgagcgttgg
ggattgcgtggcgggattcagtacgatacacgtctggataacgtagcgaccagtaactcc
agcattgaataccgtcgggatgaagaccgtctggtacagctgaattaccattacgccagc
ccggaatatattcaggctacgctgcctaagtactattccactgctgagcaatataagaat
ggtatttcgcaggtaggtgctgtcgccagcaggccaattgccgatcgttggtccattgtt
ggggcctactactacgacaccaatgcgaacaagcaagccgactctatgttaggtgtgcaa
tacagctcctgctgctatgcaattcgcgtcggttacgagcggaagctgaacggttgggat
aacgataaacaacatgcggtatatgacaacgcaatcggctttaacatcgaacttcgcggc
ctgagctccaactacggtctgggtacgcaagagatgctgcgttcgaacattctgccgtat
caaaacactttgtga

DBGET integrated database retrieval system