KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0675
Entry
SFV_0675          CDS       T00377                                 

Gene name
ybeK
Definition
(GenBank) putative tRNA synthetase
  KO
K01250  pyrimidine-specific ribonucleoside hydrolase [EC:3.2.-.-]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SFV_0675 (ybeK)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.-  Glycosylases
    3.2.-.-  
     SFV_0675 (ybeK)
SSDB
Motif
Pfam: IU_nuc_hydro
Other DBs
NCBI-ProteinID: ABF02915
UniProt: Q0T6R1
Position
710594..711529
AA seq 311 aa
MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLRMLTLLNRTD
IPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTAVELMAKTLRESAEPVT
IVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAAEFNIYVDPEAAEIVFQS
GIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDFFLEYHKDEKWGFVGAPLH
DPCTIAWLLKPELFTTVERWVGVETQGKYTQGMTVVDYYYLTGNKPNATVIVDVDRQGFV
DLLADRLKFYA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcactgccaattctgttagattgcgacccaggtcatgatgacgctatcgcaatagtt
ctcgccctcgcctcaccagagcttgatgtcaaagcaattacgtcttccgccggaaaccag
acaccagaaaaaaccttacgcaatgttctgcgtatgctgaccttgcttaatcgcaccgat
attccggtggcaggcggcgcggtaaaaccgttaatgcgtgagttgattatcgcggacaat
gtgcacggcgaaagcggtctcgacggcccggcattaccggaaccgacgttcgcaccgcaa
aactgtacggcggtggagctgatggcgaaaacgctgcgcgaaagtgcggaacctgtcacg
attgtttctaccggaccgcaaactaacgttgccttgctgctcaatagccatccggaactg
catagcaaaattgcccgtatcgtgattatgggcggcgcaatggggcttggtaactggacg
cctgcggctgaatttaatatttacgttgacccggaagcggcagaaattgtcttccagtca
gggatcccggtggtgatggccggtctggatgttactcataaagcgcaaatccacgttgaa
gacaccgagcgtttccgcgcgattggcaaccctgtttcaaccattgttgccgaactgctg
gatttcttcctcgaatatcataaagacgaaaaatggggctttgtcggcgcaccgctgcat
gacccatgcaccatcgcttggctgttgaaacccgagttgtttaccactgttgagcgctgg
gttggcgtggaaacacaggggaaatatacccagggtatgacggttgttgattattattat
ctgactggcaataaaccgaatgccactgtaattgtcgatgttgatcgtcagggctttgtt
gatttactggctgatcgtctgaaattttacgcttaa

DBGET integrated database retrieval system