KEGG   Shigella flexneri 8401 (serotype 5b): SFV_1621Help
Entry
SFV_1621          CDS       T00377                                 

Gene name
ydgB
Definition
(GenBank) putative oxidoreductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00670  One carbon pool by folate
sfv00790  Folate biosynthesis
sfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SFV_1621 (ydgB)
   00670 One carbon pool by folate
    SFV_1621 (ydgB)
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SFV_1621 (ydgB)
    1.5.1.50  dihydromonapterin reductase
     SFV_1621 (ydgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ABF03794
UniProt: Q0T4H1
Position
1654721..1655443
Genome map
AA seq 240 aa AA seqDB search
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKTTHGLRAILHNASAWIAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHVAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacacac
tatccagccattgatggactgattaatgcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaaccacccatggtctgcgt
gctattttgcataacgccagtgcgtggattgcggaaaaaccgggtgcgccactggccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatgttgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagttgctttgtcaccggacgcagtttcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system