KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2900Help
Entry
SFV_2900          CDS       T00377                                 

Gene name
recC
Definition
(GenBank) ATP-dependent dsDNA/ssDNA exonuclease V subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SFV_2900 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfv03400]
    SFV_2900 (recC)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SFV_2900 (recC)
DNA repair and recombination proteins [BR:sfv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SFV_2900 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ABF04974
UniProt: Q0T141
Position
complement(2966387..2969755)
Genome map
AA seq 1122 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
DFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEREDFTLLRHYLTDDSD
KRKLFQLSSKAADLFDQYLVYRPDWLAQWETGHLVEGLGEAQAWQAPLWKALVEYTHELG
QPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLF
TNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSR
SDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEAPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQSIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQKPKRGDRSRRDDDRYLFLEAL
ISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHL
TCLHTRMPFDPQNYQPGERQSYAREWLPAASQAGKAHSEFVQPLPFTLPETVPLETLQRF
WAHPVRAFFQMRLQVNFHTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGVQITGWLPQVQ
PDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNGESRLFLRKDGEWRFPPLAAEQALHYL
SQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAMLDDDSTLQKARTKFLQAYEGNMM
VRGEGDDIWYQRLWRQLTPETMEAIVEQSQRFLLPLFRFNQS
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccattccaatcgtctggacgtgctggaagcgttgatggagtttatt
gtcgaacgcgaacggctggacgatcctttcgaaccagagatgattctggtgcaaagtacc
ggtatggcgcagtggctgcaaatgaccctgtcgcaaaagtttggtattgcggcaaacatt
gattttccgctgccagcgagctttatctgggatatgttcgtccgggtgttaccggaaatc
cccaaagagagcgcctttaacaaacagagcatgagctggaaactgatgactctgctgccg
caattgctggagcgcgaagactttaccctgttgcggcattatctgactgacgatagcgac
aagcgaaaactgttccagctttcctcaaaagcggcggacctgtttgaccagtatctggtc
tatcgtccggactggctggcacagtgggaaacaggacatttggttgaagggctgggagaa
gcacaggcctggcaagccccgttgtggaaggcgctggtggaatatacccatgaactcgga
caaccgcgctggcaccgcgcgaatctctatcagcgctttatcgaaacgctggagtccgcg
acgacctgcccgccggggttaccttcgcgcgtctttatatgcggtatttccgcgttaccg
cctgtttatctccaggcgctccaggcgctgggtaaacatattgaaatccatctcctgttt
accaacccctgccgttattactggggcgatattaaagatcctgcttatctggcgaaactg
ctgactcgtcagcgtcgacacagttttgaagatcgcgaattgccgctatttcgcgatagc
gaaaatgccggacagctctttaacagcgatggtgaacaggatgtcggcaacccgctgctg
gcctcatgggggaagcttgggcgcgactacatttatctcctttctgacctggagagcagc
caggagctggacgcttttgtcgatgtgacgccagataacctgctgcataacattcagtct
gacattctggaactggaaaaccgcgccgttgcgggtgtgaacatcgaagagttttcccgt
agcgataacaaacgcccgcttgatccactggatagcagtatcacattccacgtttgccat
agcccgcagcgtgaagttgaagttttacacgatcgcttgctggcgatgctggaggaagcc
ccgacacttactccgcgcgacatcatcgtgatggtggctgatatcgacagctacagtccg
tttattcaggcagtgtttggtagcgcacctgcggatcgttacctgccttacgccatttcc
gaccgtcgtgcgcggcagtcacatccggtactggaagcgtttatcagcctgttatcactg
cctgacagtcgctttgtgtcagaggatgtgctggcgctgctggatgtgccggtgctggcg
gcgcggtttgacatcaccgaagaagggctgcgttatttacgccagtgggtcaacgaatcc
ggcattcgttgggggatagatgacgacaacgttcgcgagctggaactccccgccaccgga
caacacacctggcgatttggcctgacgcgtatgttgctgggctacgcgatggagagcgcg
cagggcgagtggcaatcggttctaccttatgatgaatcgagcggcttaattgcagaactg
gtggggcatctggcttcactgctaatgcagctaaacatctggcgtcgcgggctggcacag
gagcgtccgctagaagagtggttgccggtttgtcgcgatatgctcaacgccttcttcctg
ccggatgcggaaaccgaagcggcgatgacgctgatcgaacaacaatggcagtcgattatc
gccgaaggtttaggtgcgcagtatggcgacgcggtgccgctgtcactattgcgtgatgaa
ctggcacagcgtctggatcaagaacgtatcagccagcgttttctcgccggaccggttaac
atttgtactctgatgccaatgcgttcaattccgttcaaagtggtttgcctgctgggaatg
aacgacggcgtttatccacgtcagcttgcgccattgggctttgacctgatgagccagaaa
ccgaagcgtggcgaccgtagccgtcgcgatgacgaccgctacctgttcctggaagcgtta
atttccgcgcagcaaaaactctatatcagctatatcgggcgttccattcaggataacagt
gaacgtttcccgtcggtactggtgcaggaactgatcgactacatcgggcaaagtcattat
ctaccgggcgatgaagcgctcaactgtgatgaaagcgaggcaagggtaaaagcgcatctt
acttgcctccatacccggatgccgtttgatccgcaaaactaccagccaggcgaacgacaa
agctatgctcgtgaatggctacctgcggccagccaggctggtaaagcacattctgaattt
gttcagccgctgccgtttaccttaccggaaaccgtgccgctggaaacgctacaacgattc
tgggcacatccggtgcgggcgttcttccagatgcgtttgcaggtgaacttccatactgaa
gacagcgaaatcccagacaccgagccatttattctggaaggacttagccgttatcaaatc
aatcagcagttattgaatgcactggttgagcaggatgatgccgaacgcttgttccgccgc
ttccgggcggcaggggatttaccgtatggcgcttttggtgaaattttctgggaaacacag
tgccaggagatgcagcagcttgccgacagagtcattgcctgtcgccagccggggcagagt
atggaaattgatctcgcctgcaacggtgtgcagataactggctggttgccgcaggtgcag
ccggatggcctgttgcgctggcgtccctctttattaagtgtggcgcagggaatgcaactt
tggctggaacaccttgtctactgtgccagcggtggtaatggcgaaagtcgcctttttcta
cgcaaagacggtgagtggcgttttccgccgcttgcagccgaacaggctttgcattacctc
tcacaactgattgaggggtatcgtgaaggaatgtccgcgccattgctggtgttacctgaa
agtggcggcgcgtggctaaaaacctgttatgacgcgcaaaacgatgccatgctggatgac
gattccacgttgcaaaaagcccgtacgaaattccttcaggcttacgaaggcaacatgatg
gtgcgtggcgaaggtgatgatatctggtatcaacggctctggcggcaattaacaccagag
acaatggaggccatcgttgaacagtcgcaacgtttcctgttaccgctgtttcgctttaat
cagtcatga

DBGET integrated database retrieval system