KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2922Help
Entry
SFV_2922          CDS       T00377                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00071  Fatty acid degradation
sfv00280  Valine, leucine and isoleucine degradation
sfv00310  Lysine degradation
sfv00362  Benzoate degradation
sfv00380  Tryptophan metabolism
sfv00620  Pyruvate metabolism
sfv00630  Glyoxylate and dicarboxylate metabolism
sfv00640  Propanoate metabolism
sfv00650  Butanoate metabolism
sfv00900  Terpenoid backbone biosynthesis
sfv01100  Metabolic pathways
sfv01110  Biosynthesis of secondary metabolites
sfv01120  Microbial metabolism in diverse environments
sfv01130  Biosynthesis of antibiotics
sfv01200  Carbon metabolism
sfv01212  Fatty acid metabolism
sfv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFV_2922 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SFV_2922 (yqeF)
   00640 Propanoate metabolism
    SFV_2922 (yqeF)
   00650 Butanoate metabolism
    SFV_2922 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFV_2922 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SFV_2922 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFV_2922 (yqeF)
   00310 Lysine degradation
    SFV_2922 (yqeF)
   00380 Tryptophan metabolism
    SFV_2922 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFV_2922 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFV_2922 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFV_2922 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfv04147]
    SFV_2922 (yqeF)
Enzymes [BR:sfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SFV_2922 (yqeF)
Exosome [BR:sfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFV_2922 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: ABF04995
UniProt: Q0T120
Position
complement(2991735..2992916)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system