KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2931
Entry
SFV_2931          CDS       T00377                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00230  Purine metabolism
sfv01100  Metabolic pathways
sfv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SFV_2931
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SFV_2931
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABF05002
UniProt: Q0T113
Position
2999090..3001387
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALTEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRICSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtttaccgggcgtactggcgatttttacttgggaagatgtgcctgatattccattc
gctacagctgggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgcgca
ctgctaactcgccatgttcgtcatcatggtgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcaccacgccagaagcggcgctgacagaagacgctgcaccaatccataacggcggcaat
ttactgaaacaaagcacgatgtcgacgggcaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagactcccgttattcaacattgtcacatggaaagcgta
acatcgctggcgtggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgaccagcaagcttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaaccttgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccatcgcttctgcgggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgac
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggcaaacgtatttgcagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgccagaaccagcaa
ggcaatttgcgccgcggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcgcaaatggtggca
gaaaccgtgggggttccggtcagcgacgttcgcgttatttcaacacaagataccgacgtt
acgccgttcgatcccggcgcatttgcctcacgccagagctatgttgccgcgcctgcgctg
cgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatttgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgctgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatcaaccgcatcctc
aacgttcatgattcagggcatattcttaatccactgctggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcatcgatgctaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccacccataattcctgttgccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctgacgccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system