KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3613Help
Entry
SFV_3613          CDS       T00377                                 

Gene name
rbn
Definition
(GenBank) tRNA processing exoribonuclease BN
  KO
K07058  membrane protein
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SFV_3613 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ABF05643
UniProt: Q0SZ72
Position
complement(3691780..3692652)
Genome map
AA seq 290 aa AA seqDB search
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA
FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI
DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccattcaggacaaagccaggcaccgtacccgtccactatgggcctggcta
aaactactctggcaacgtattgatgaggacaacatgacaaccctggcaggtaaccttgcc
tatgtgtcgttgctctcattagtgccgctggttgccgttgtttttgcgcttttcgccgct
tttcccatgttttccgacgtcagcattcagttacgtcactttatttttgccaactttctg
cctgctactggcgatgttattcagcggtatatcgaacaatttgttgctaattccaacaag
atgaccgccgttggggcgtgcgggctgatcgtcaccgcgttattgttgatgtactccatc
gatagcgcgttgaataccatctggcgcagtaaacgagcgcgaccaaaaatttactcgttc
gccgtgtactggatgattttaacgctggggccgctgctggcaggggccagtctggcgatc
agttcctatttgctctccctgcgctgggcgagcgatctcaatactgtcatcgacaacgtg
ctgcgtatttttccgttgctgttgtcgtggatctccttctggttgctgtacagcattgtt
cctaccatccgcgtacctaaccgcgacgcgattgtcggcgcgtttgtcgccgcactcctg
ttcgaagcaggaaagaaaggtttcgcgctttatatcaccatgttcccgtcatatcagctc
atttacggtgtgctggcggtgatccccattctctttgtttgggtctactggacatggtgt
atcgtcttgcttggcgcggaaattactgtcactctcggggaataccgcaaactaaaacaa
gcagctgaacaagaagaagacgacgaaccatga

DBGET integrated database retrieval system