KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3937Help
Entry
SFV_3937          CDS       T00377                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00051  Fructose and mannose metabolism
sfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SFV_3937 (mtlD)
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SFV_3937 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: ABF05945
UniProt: Q0SYC0
Structure
PDB: 

Position
complement(4038196..4039518)
Genome map
AA seq 440 aa AA seqDB search
MMSPSSSVWHTPPAWMKCWNCWQVVSNPILPSPHGEGLGEGKASPQPSRVKTLMKVNTMK
ALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTVSG
VNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIACEN
MVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFSEW
IVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAILDE
KIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRKLS
AGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQIS
GLDANSEVVSEAVTAYKAMQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtccgtcatcgagcgtctggcacacaccaccagcgtggatgaagtgctggaac
tgctggcaggtcgtaagtaatccaatcctaccctctcctcacggagagggtttgggtgag
ggaaaagcctcaccccagccctctcgggtaaaaacattgatgaaggttaatactatgaaa
gcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctggcagac
gcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctgaatgcc
cgtcatagctatcaggttcatgtggtcggtgaaaccgagcaggtagataccgtttccggc
gtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtcgattta
gtcactaccgccgttggcccggttgtgctggaacgtattgctccggctatcgccaaaggg
ctggtgaaacgcaaagaacaaggtaatgaatccccgctgaacatcatcgcctgtgaaaac
atggtacgcggcaccacgcagctgaaaggtcatgtgatgaacgccctgccggaagacgcc
aaagcgtgggtagaagagcacgttggctttgtcgattccgccgttgaccgcatcgtaccg
ccttcggcttcggcaactaacgatccgctggaagtgacggtagaaactttcagcgaatgg
attgtcgataaaacgcagttcaaaggcgcactgccgaacatcccaggcatggagttaacc
gacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcatgctata
accgcgtacctcggaaaactggccggtcatcagaccattcgtgacgctattctcgacgag
aaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcggtactgatcaagcgc
tacggctttgacgcagacaaacatgcggcgtacatccagaaaatcctcggtcgttttgag
aacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccgctgcgtaaactgagt
gctggcgaccgtctgatcaagccactgctcggtacgctggaatacagccttccgcacaag
aatctgattcaggggattgctggtgcaatgcacttccgcagtgaagatgatccgcaggct
caggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacagatttcc
ggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagcaatgcaa
taa

DBGET integrated database retrieval system