KEGG   Serratia fonticola DSM 4576: WN53_05090Help
Entry
WN53_05090        CDS       T04030                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00071  Fatty acid degradation
sfw00280  Valine, leucine and isoleucine degradation
sfw00310  Lysine degradation
sfw00362  Benzoate degradation
sfw00380  Tryptophan metabolism
sfw00620  Pyruvate metabolism
sfw00630  Glyoxylate and dicarboxylate metabolism
sfw00640  Propanoate metabolism
sfw00650  Butanoate metabolism
sfw00900  Terpenoid backbone biosynthesis
sfw01100  Metabolic pathways
sfw01110  Biosynthesis of secondary metabolites
sfw01120  Microbial metabolism in diverse environments
sfw01130  Biosynthesis of antibiotics
sfw01200  Carbon metabolism
sfw01212  Fatty acid metabolism
sfw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WN53_05090
   00630 Glyoxylate and dicarboxylate metabolism
    WN53_05090
   00640 Propanoate metabolism
    WN53_05090
   00650 Butanoate metabolism
    WN53_05090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WN53_05090
   00072 Synthesis and degradation of ketone bodies
    WN53_05090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WN53_05090
   00310 Lysine degradation
    WN53_05090
   00380 Tryptophan metabolism
    WN53_05090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WN53_05090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WN53_05090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WN53_05090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfw04147]
    WN53_05090
Enzymes [BR:sfw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WN53_05090
Exosome [BR:sfw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WN53_05090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKG68548
UniProt: A0A0F7H8X5
Position
1159346..1160530
Genome map
AA seq 394 aa AA seqDB search
MKNANDIVVVSGVRTAIGTMGGSFKDTHQHDLGAAVIREAVARAGLQPAQIDEVVVGNVG
QIAESGFIARICQLRAGLPNETTSYSVNRQCGSGLQAIVDCMLELQTGNAEITVACGTEN
MTQLPHYIRKARYGYRLGHGELEDGIVSILTWPEGPYHNGMTAEFVAERFHISREAMDEF
AWCSQQKALAAIKEGHFTSQILPLEVREGKNSRLFATDEHPRDTPKEKYAQLKPAFKKDG
TVTAATSSGINDGAAALVVTTRSNAEKLGLPIRMVIRGWAVAGCEAEIMGFGPAPATRKL
MQKLNMSVHDIDLIELNEAFAAQSLAVINDLELDPAKVNVNGGAIALGHPVGASGAIIAV
KLMYEMERRGVNTGLATMCIGGGQGISMLFERER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcaaatgatattgtcgtcgtcagcggcgtacgcacggcgatcggcaccatg
ggcggtagctttaaagatacacaccagcatgatttgggcgctgcggtgatccgtgaggcc
gtggcccgtgccgggctgcaacctgcacaaattgatgaggtggtggtaggtaacgtcggg
caaatcgcggagagtggctttatcgcccgcatttgccaactgcgcgcgggcttaccaaac
gaaacaacatcctattcggtaaaccgccagtgtggttcgggtctgcaagcgattgtcgat
tgcatgctggaactgcaaaccggtaacgccgagatcaccgtcgcctgtgggacagagaat
atgactcaactgccccactatattcgcaaggctcgttacggttatcgccttgggcatgga
gagctggaagacggcatcgtctctattttaacctggccagaaggcccttatcacaacggt
atgaccgccgagttcgtcgcggaacgttttcacatcagccgtgaggcaatggacgagttt
gcctggtgcagtcagcaaaaagccttggcagccatcaaagaggggcattttacctcgcaa
atcctgccgctggaggtccgtgaaggcaagaacagccgcctgtttgccaccgatgagcac
ccaagggatacgccgaaagaaaagtatgcgcagctgaaaccggcgtttaaaaaagacggc
acggtcacggcagcaacgtcatcaggtattaatgatggagccgccgcgctggttgtcacc
acccgatccaacgctgaaaaactggggctaccaatcaggatggtgatccgaggctgggca
gtggcaggttgcgaggcagaaatcatgggctttggcccggctccggcaactcgtaaactg
atgcaaaagttgaacatgtcggtgcatgatatcgatcttattgagctaaatgaggccttt
gccgcccaatcattggcggtgattaacgatcttgagttggatccggcgaaagtgaacgtc
aacgggggagccattgcgctggggcaccctgttggggccagtggtgccatcatcgccgta
aaactgatgtatgagatggagcgccgtggcgtcaataccggcttagccactatgtgtatc
ggtggaggccaagggatctctatgctgtttgagcgggaaaggtag

DBGET integrated database retrieval system