KEGG   Serratia fonticola DSM 4576: WN53_14155Help
Entry
WN53_14155        CDS       T04030                                 

Definition
(GenBank) histidine kinase
  KO
K13040  two-component system, LuxR family, sensor histidine kinase TtrS [EC:2.7.13.3]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WN53_14155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfw01001]
    WN53_14155
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sfw02022]
    WN53_14155
Enzymes [BR:sfw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     WN53_14155
Protein kinases [BR:sfw01001]
 Histidine kinases
  LuxR family [OT]
   WN53_14155
Two-component system [BR:sfw02022]
 LuxR family
  TtrS-TtrR (tetrathionate respiration)
   WN53_14155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphonate-bd HATPase_c HisKA HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AKG72592
UniProt: A0A0F7HI26
Position
complement(3196610..3198346)
Genome map
AA seq 578 aa AA seqDB search
MILLCGWLSPAWAGQWTIAVLALRGDTHALAQWQPLINHLNRQFPDESFQLLPLNLADMG
EAVSNGQVDFLLTNPAQYIQLDNSYPLRWLVSLRSSQNQQNASNNVIGSVVLVRRDSPVT
EANQLTGKKVGAVSPDAFGGYLLGYKELLAAGIHPEKDLQLHFSGYPVDALLYLLRDRAL
DAAIVPVCLLEEMEKEGLLKADDYRALLAKPSTQPCLTSSVLYPNWSFAALNHVPDPLVD
ELTRQLLQVDTPGLPAWGAPASSRQVDQLLRDLDRHPAQRSLWQEIHSWALQHLLLLGTI
AGGMLLLGANHLWIGHLVRLRGRELEQMHLTLRAREAALARAQRLSTLGEMASGFAHELN
QPLAAIRHYAEGCRIRLERSDPQHELLPILEQIGQQAQRGAETIVNLRQWVSKTPHHESA
QWLTLRPLVENVIKLMRIEQHYPQCRLAIIIAPKSQLYSQATLLEQVLTNLLNNSLQAGS
QQITLRLETDGDRQTLILEDDGGGLSAEQLAQPFVPFRSTKSEGLGLGLVICQRLLRSQQ
GELTLENYSISPQRQGLRVTLLFPEIKKETRHGADTSG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgctatgcggctggttaagcccggcctgggcggggcaatggaccatcgccgtg
ctggcattacgcggcgatacacatgccctggcccaatggcagccgttaattaaccatctc
aatcgtcagttcccagacgaaagctttcaactgttgccgctgaacctggccgatatgggg
gaagccgtcagcaacggccaggtcgattttctgctcaccaacccggcgcagtatattcag
ttggacaatagttacccgttacgctggttggtctccttacgctccagccaaaatcagcag
aacgcctcaaacaacgtgataggcagcgtggtattggtacgccgcgatagccctgtgacc
gaggctaatcagctcactggtaaaaaagtgggcgcggtctcccctgacgcgtttggcggc
tatctgctgggctataaggagctgctggccgccggcatacatccggaaaaagatctgcaa
ctgcacttcagcggttatcccgtggacgccctgctttatctgttgcgcgatcgggcgctg
gatgcggccatagtgccggtttgcctgttggaagagatggagaaagagggattactcaaa
gccgatgattaccgtgccctgctggccaaacccagcacacagccctgcctgaccagcagc
gtgctttatcccaactggtcgtttgccgccttgaaccacgtgcccgatcccctggtcgat
gagctgacccgccagttgttgcaagtggataccccaggtctccctgcctggggcgctccc
gcctcatcccgccaggtagatcaattgctgcgcgatctggatcgccatcctgcacagcgt
tcactctggcaagagatacacagttgggcattgcaacatctgctcctgcttggcacgatc
gccggaggcatgttactgcttggcgctaaccatctgtggatcggccacctggtccgcctg
cgtgggcgcgagctagaacaaatgcatctgacgctgcgggccagagaagcagcgctagcc
cgggcgcaacgcctcagcaccctgggtgagatggcttccggtttcgctcacgaacttaac
cagcctctggcggctattcgccactacgccgaaggttgccgtattcgccttgagcgcagc
gatccgcagcacgagctgttgccgatcctcgaacagattggccaacaggcgcagcgaggg
gcagaaaccatcgtcaatctgcgccaatgggtcagcaaaacgccacaccatgaaagcgca
caatggctaacgctgcgccccctggtggaaaatgtcatcaagctgatgcgcatcgaacag
cattaccctcagtgccggctggccatcatcatcgccccgaaaagccagttgtatagccag
gccacgctgttggagcaggtgctaaccaacttgttaaacaacagcctgcaggccggttcc
cagcagatcaccctgcggctggaaaccgatggcgatcggcagacgctaatactggaagac
gatggcggcggcctcagcgccgaacagttagcacagccgttcgtgccttttcgcagcact
aaatcggaaggacttggcctggggctggtgatctgccagcggctgctaaggagccagcag
ggggaactgacgctggaaaattattcgatttcgccacaacggcaggggctacgcgttacc
ctgctcttccctgagatcaaaaaggaaacacgccatggcgctgatacatctggttga

DBGET integrated database retrieval system