KEGG   Serratia fonticola DSM 4576: WN53_18725
Entry
WN53_18725        CDS       T04030                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00230  Purine metabolism
sfw01100  Metabolic pathways
sfw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WN53_18725
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKG70993
UniProt: A0A0F7HE80
Position
complement(4234345..4234821)
AA seq 158 aa
MLINCTINGRPYQFEVDPRLSLMELLRQQGLNSVKQGCSVGECGACTVLIDDVATDTCIY
LALWADGKTIRTTEGEVKQGKLSAVQQAYVNVGAVQCGFCTPGLVMTSTSMVERFRGHRL
TEQEIRRGLAGNLCRCTGYTSIVKAVEQAQQLDEEMPS
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttgatcaattgcaccatcaatggccgcccctatcagttcgaggtcgatccccgcctg
tcgctgatggagttattgcgccagcaagggcttaacagcgtcaaacaagggtgtagcgtg
ggcgagtgtggtgcctgtaccgtactgatcgacgatgtggctaccgatacctgcatttat
ctggcgctctgggccgatggcaaaaccatccgcaccaccgagggcgaggtgaaacagggc
aaactgtctgccgtacagcaggcttatgtgaatgtgggggccgtgcagtgtggtttttgt
acgccggggttggtgatgaccagtacctcaatggtggaacgctttcgcggccaccgcctc
accgagcaggagatccgccgcggcctggccgggaatttatgccgctgcactggctatacc
tcgatcgtcaaggcggtggaacaggcgcagcagctggatgaggagatgccgagttga

DBGET integrated database retrieval system