KEGG   Serratia fonticola DSM 4576: WN53_18735
Entry
WN53_18735        CDS       T04030                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00230  Purine metabolism
sfw01100  Metabolic pathways
sfw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WN53_18735
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     WN53_18735
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKG72631
UniProt: A0A0F7HHW7
Position
complement(4235709..4237994)
AA seq 761 aa
MPVGTSPERVDAQAKVTGRARYTDDMTMPGMRHAKYVRSPIAHGLVTRIDTSKALQLPGV
EAIFTYQDVPQHGFPTAGHAWSLDANKRDVADKQLLTQHVRHHGDGVAIVVARDVLTAEK
AAMLVEVEYQELPVMTTAKTALAADAPLLHGGKSNLLKQHQLNGGDPVAALAASEVVIEG
NYSTQVVQHCHLEGVISYAYMDEMDRIVIVSSTQIPHLVRRVVGQALDRPWSSIRVIKPY
IGGGFGNKQDVLEEPMAAFLTWKLGGVPVKVELSREECFLASRTRHSFAISGKMGINRDG
ILQTYSLEVLSNTGGYASHGHSIASAGANKIAYLYPRIAFGYKATTFYSNLPNAGAMRGY
GAPQVTFALECMIDEAAAQLGMDPLELRLKNVARQGDLNPLNHKEIKSAGIIECLQKGRE
LFDWDARRAACLNQSGPIRRGVGVACLSYASNTYPVGVEIASARLLLNQDGTIHLQVGAT
EIGQGSDTVFAQMAAQTIGVPFSSLYVISTQDTDITAYDPGAFASRQSYVAAPAIRQAAT
ELRAKILTHAAYMCNQPEWALDVINGEVVLKEMPEKVLCSVQEVSMSAHYDQEVGGQIMA
EVSCKTRSNPPAFGCTFVDLTVDIELCKVTINKIINLHDSGQILNPLLAEGQVHGGMGMG
IGWTLFEEMIIDEQSGIVRNNNLLDYKFPTILDLPELDCAFVETYEPQSAYGHKALGEPP
LISPAPAIRNAIWMATGVKIDELPLTPKTLYRYFSQAGLIE
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgcctgtaggaacttcgcccgaacgcgtcgatgcacaagccaaagtcaccggccgggcg
cgttataccgacgatatgaccatgcccggtatgcgtcatgccaaatatgtccgtagcccg
attgcccatggcctggttacgcgtatcgacaccagcaaagccctgcaactgccaggggtg
gaagccatattcacttatcaggatgtgccgcagcatggttttccgactgccggccacgcc
tggtcgctggatgccaataagcgtgacgtagcggataaacagttgctgacccagcatgta
cgccatcacggcgatggcgtggcgatcgtggtcgcccgcgacgtgttaacggcagagaaa
gccgccatgttggttgaagtggaatatcaggaactgccagtgatgaccacagctaaaacc
gcgctggcagccgatgcgccgctgttacacggcggtaaaagcaatctactgaaacagcac
cagctcaacggcggcgatcccgtggcagcattggctgcgtcagaggtcgtgatcgaaggc
aactacagcacgcaggtagtgcaacattgtcatctggaaggggtgatttcttacgcttac
atggacgagatggatcgcatcgtgatcgtctcaagcacccaaattccccatctggtacgc
cgtgtggtaggccaggcgctggatcggccatggtcatccatcagggtgatcaaaccctat
atcggcggcgggttcggcaataagcaggacgtattggaagagccgatggccgcattcctg
acctggaaactcggcggcgtgccggtcaaggttgaactgagccgcgaagagtgctttttg
gcgtcacgcacacgccactcgttcgccatcagcggtaagatgggcattaaccgcgacggc
atcctgcaaacctatagcctggaggtgctctccaataccggaggatatgcttctcacggc
cattccattgcctccgccggggccaataaaatcgcctatttgtatccgcgtatcgccttc
ggctacaaagccaccaccttttactccaacctgccgaacgccggagccatgcgcggctac
ggtgcaccacaggtgacctttgccctggaatgcatgattgacgaagccgccgcccaactg
gggatggatccgctggaactgcggctcaaaaacgtcgcccgccaaggagatctcaaccca
ctcaatcataaagaaatcaagagcgccgggattatcgaatgcctgcaaaaaggccgggaa
ttgtttgactgggatgcccgtcgtgccgcctgcctgaaccaaagtggccccatccgtcgc
ggcgttggcgtggcctgcctgagctatgcgtccaatacctatccagttggcgtcgagatt
gccagcgcccggttgttactcaaccaggacggcaccatccatctgcaagtcggcgcgaca
gaaattggccagggatcggataccgtgtttgcacaaatggcagcgcaaaccatcggcgtg
cccttctcttccctctacgttatctccacccaagacaccgatattaccgcctacgatccc
ggtgccttcgcctcgcggcaaagctatgtcgcagccccagccatccgccaggccgctacc
gaactacgcgccaagatcctgacccatgcggcctatatgtgcaaccagcccgaatgggcg
ctagatgtgatcaacggcgaggtggtgctgaaggagatgccggaaaaagtgttgtgctcg
gtgcaagaggtctccatgagcgcccattacgatcaggaggtcggcgggcagattatggcc
gaggtttcctgcaaaacccgcagcaatccacccgcctttggctgcacctttgttgacctc
accgtcgatattgagctgtgtaaggtcaccatcaacaagatcattaatctgcacgattcc
ggccagatccttaacccactgctggccgagggacaggtgcatggcggcatggggatgggc
atcggctggacgctgttcgaagagatgatcatcgacgagcaaagcggcatcgtgcgcaat
aacaatctgctggattacaagttccctaccattctcgatctgccagagttggactgtgcg
tttgtcgaaacctatgagccgcaatccgcctatgggcacaaggcgctgggtgaaccgccg
ctgatctctcccgccccggcgatccgtaacgccatctggatggcaaccggcgtgaagata
gatgagttaccgctgacgcccaaaacgctgtatcgctacttttcgcaggcgggcctgatc
gagtaa

DBGET integrated database retrieval system