KEGG   Serratia fonticola DSM 4576: WN53_24530Help
Entry
WN53_24530        CDS       T04030                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00010  Glycolysis / Gluconeogenesis
sfw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WN53_24530
Enzymes [BR:sfw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     WN53_24530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AKG72034
UniProt: A0A0F7HFS7
Position
complement(5511597..5512829)
Genome map
AA seq 410 aa AA seqDB search
MRKKTLLLCLPLLFSGTAFAENDGYQLEQVLVMSRHNLRAPLANNGSVLAQSTPKAWPQW
DTPGGLLTTKGGVLEVYMGHYFNAWLKQAGILPQEGCPAADSVYVYANSLQRTVATAQFF
TNGAFPGCDISVHHQEKMGEMDPTFNPIITDNSEAFNQQALSAMNAELASLKLDASYKQL
EQIIDYKDSPACKTDKQCNLATEPNKMSAVPGKEPGVSGPLKVGNSLVDAFMLQYYEGFP
MKDVAWGKIVTPHQWQQLAKLKDGYQDSLFTSSVVAQNVAKPLLTYINSALISERKADSP
KLTVLVGHDSNIASLLSAMKFKPYELPKQYEKTPIGGKLVFQRWHDGKGDRDLLKIEYVY
QSTEQLRNAEPLTLSTPPQRVTLALEGCPVDKDGFCAWSDFEKTMKDVLH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaacgttattactttgcctgcctttgctgtttagcggcaccgcctttgcc
gagaacgacggttatcaactggaacaggtgctggtaatgagccgccataacctgcgcgca
ccgttggcgaacaacggcagcgtgttagcccagtccacgccgaaagcctggccacagtgg
gatacgccaggtggcttgctgaccaccaagggcggcgtgctggaagtgtatatgggccac
tatttcaacgcgtggctcaagcaggcgggcattttgccgcaggaaggttgcccggccgct
gacagcgtttacgtgtatgccaacagcctgcaacgcaccgtagccaccgcgcagttcttt
accaacggcgcgttccctggctgtgatatcagcgtgcatcatcaggagaaaatgggggag
atggatcctaccttcaacccgattatcaccgacaacagcgaagcctttaaccagcaggcg
ctgagcgccatgaatgccgagctggcatcgctgaagctggacgcctcctacaaacagctc
gagcagatcatcgactacaaagactctcctgcctgcaagactgacaagcagtgcaacctg
gccactgaaccgaacaaaatgagcgcggtgccggggaaagagccaggcgtttctggcccg
ctgaaagtgggtaactcgctggtggatgcctttatgctgcaatattacgaaggcttcccg
atgaaagacgtggcctggggcaagatagtgacgccgcaccagtggcagcagttggccaag
ctgaaagatggctatcaggattcgctgttcacctcgtcggtcgttgcccagaacgttgcc
aagccgctgctgacctacatcaattcggcgctgatcagtgagcgcaaggcagattctccg
aagctgaccgtgctggtggggcatgattccaacatcgcctccttactatcagcgatgaag
ttcaagccgtatgaattgccgaagcagtatgagaagaccccgattggcggcaagctggtg
ttccaacgctggcatgatggcaaaggcgatcgcgatctgttgaagattgagtatgtctat
caatcaaccgagcagttgcgtaatgccgaaccgctgacgctaagcaccccgccgcagcgc
gtcaccctggcgctggaaggctgcccggtagataaagacggcttctgcgcctggagcgac
tttgaaaaaaccatgaaggacgtcttgcattaa

DBGET integrated database retrieval system