KEGG   Shigella flexneri 2457T (serotype 2a): S0211
Entry
S0211             CDS       T00128                                 

Gene name
safA
Definition
(GenBank) putative cytoplasmic protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfx02044]
    S0211 (safA)
Secretion system [BR:sfx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   S0211 (safA)
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AAP15744
UniProt: A0A3Y2RUJ7
Position
complement(229169..230215)
AA seq 348 aa
MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVSTPENINWAELERDAH
RLLMRSKDIRILVVLLRCRIQQAGARGLSEALTLLETLCSTYPDAIHPQLLATEDITAED
AAVARSNALAALLDHEGVMADIRGITLSNNAAMRLQVRDVERSLSALRPADALAPESVRQ
QLADLEARGTLPLDAFRQAAETTERLQRHARETLNDQAPDFSRLTQLLALLPGAVQSTTP
EILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPMTGAEPRQIRDRNDALERLRV
IRRWFEHSEPSSPTIPLLRQAERLVGKRVSEVINEIPVELLEKWDALE
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaaatattcctgtctgacccaatttcggcggaatgcccctgcggcccggatctggag
tacgatccggaatacctgctgctgttcacccgcgccgcaccgcgtgaagaagcgcaatat
ggcgattttgtcagtacgccggaaaacattaactgggcggagcttgagcgggacgcccat
cgtctgctgatgcgcagcaaagatatccgcattctggttgtcctgctgcgctgccgtatc
cagcaggccggtgccaggggactgtcggaggcgctcacgctgctggaaacgttgtgctcc
acgtacccggacgccatccatcctcaactgctcgcgactgaagatatcaccgccgaagat
gctgcggtggcacgcagtaacgcgctggcggcgttgctggaccacgaaggtgtaatggcg
gatattcgtggcattacactgtcaaataatgctgccatgcgccttcaggtgcgggatgtg
gagcgttcgctatctgcattacgcccggcggatgcgctggcaccagaatcggtacgccag
caactggcagacctggaagcgcgcggcacactgccgctggatgcctttcgccaggcagca
gagaccactgagcggctgcaacgccatgcgcgtgaaacgctgaatgaccaggcaccggac
ttctcccgtctgacgcaactgctggccctgttaccgggagcagtgcagagcaccacgccg
gagatcctgccacaaccacaggctgagcagccggaaaacgccaccatcgttcatactgaa
cagatgcaggcagagcagattgcgctaccggtgcatatcgcggaggaaatatcaccgatg
accggcgcagaaccccggcagatccgcgaccgaaacgacgcgctggaacgcctgcgtgtc
atccgtcgctggtttgagcacagcgaaccgagcagcccgaccattcctttgctgcgccag
gcagaacgcctggtcggaaaacgcgtctcggaggtaataaatgaaattccagtagaactg
ctggagaaatgggatgcgctggagtaa

DBGET integrated database retrieval system