KEGG   Shigella flexneri 2457T (serotype 2a): S0848Help
Entry
S0848             CDS       T00128                                 

Gene name
rimK
Definition
(GenBank) ribosomal protein S6 modification protein
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sfx03009]
    S0848 (rimK)
Enzymes [BR:sfx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     S0848 (rimK)
Ribosome biogenesis [BR:sfx03009]
 Prokaryotic Type
  ribosomal protein modification factors
   S0848 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST Dala_Dala_lig_C Arm-DNA-bind_3 ATPgrasp_YheCD ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AAP16311
UniProt: Q83S18
Position
833540..834442
Genome map
AA seq 300 aa AA seqDB search
MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIYYKGRKLPHFDA
VIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
KEAQGCDIRCLVVGDEVVAAIERRAKEGYFRSNLHRGGAASVASITPQEREIAIKAARTM
ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgccatattgtcccgggatggaacgctctattcgtgtaagcggctgcgtgaa
gccgctatacagcgcggtcacctggttgaaattcttgatccgctttcttgctacatgaac
ataaatcctgcggcgtcttctatttactacaaaggccgcaagttaccccattttgacgca
gtgatcccgcgtattggcaccgccattaccttttatgggacggcggcactgcgccagttc
gagatgctggggagctatccgctcaatgagtcggtcgccattgcccgggcgcgtgacaaa
ttgcgttccatgcaactgctggcgcgtcagggcatcgacctgcctgtcacgggcattgcg
cattcgccggatgataccagcgatttaatcgacatggtcggtggtgcgccgctggtggtc
aagttggttgaaggcacgcagggaattggcgtcgtgctggcggagactcgtcaggcggcg
gaaagcgtgattgacgctttccgcggtctgaacgcgcatattctggtgcaggaatatatc
aaagaggcgcaagggtgcgatatccgctgtctggttgttggtgatgaagtggtcgctgcg
attgaacggcgggcgaaagagggctattttcgttccaatttgcatcgtggcggcgcggca
agcgtcgccagtatcacaccacaggagcgtgaaatcgcgataaaagccgcgcgaacgatg
gcgctggacgttgctggtgtggatattctgcgtgctaatcgcgggccgttggtgatggaa
gtgaatgcgtcgccggggctggaaggaatagaaaaaaccaccggtatcgatatcgcgggt
aaaatgatccgctggatcgaacgccacgctacgacagaatattgcctgaaaacgggtggt
tag

DBGET integrated database retrieval system