KEGG   Shigella flexneri 2457T (serotype 2a): S0866Help
Entry
S0866             CDS       T00128                                 

Gene name
ybjU
Definition
(GenBank) putative arylsulfatase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00260  Glycine, serine and threonine metabolism
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01120  Microbial metabolism in diverse environments
sfx01130  Biosynthesis of antibiotics
sfx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S0866 (ybjU)
Enzymes [BR:sfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     S0866 (ybjU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: AAP16331
UniProt: A0A383JWS9
Position
complement(852346..853347)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMAGGGMRQSGILAAAGMY
ALENNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgtggcgaagagtatattgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcggtgctgggcagtattcagccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacctgaaagaagcatgggaatttacccgcgagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccatccgctgg
cggaaaatggccggtggcgggatgcgtcagtccgggattctggctgccgccgggatgtat
gccctggaaaataacgtcgcacggttgcaggaagatcacgacaacgccgcctggatggcg
gagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacactaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacgcatcttgacgtctcgcgcgaacaactg
gcggaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system