KEGG   Shigella flexneri 2457T (serotype 2a): S1309Help
Entry
S1309             CDS       T00128                                 

Gene name
narX
Definition
(GenBank) nitrate/nitrite sensor protein NarX
  KO
K07673  two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC:2.7.13.3]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    S1309 (narX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfx01001]
    S1309 (narX)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sfx02022]
    S1309 (narX)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     S1309 (narX)
Protein kinases [BR:sfx01001]
 Histidine kinases
  NarL family
   S1309 (narX)
Two-component system [BR:sfx02022]
 NarL family
  NarX-NarL (nitrate respiration)
   S1309 (narX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c HAMP PilJ HATPase_c_3 HATPase_c_2 Ni_hydr_CYTB NES_C_h PsbH
Motif
Other DBs
NCBI-ProteinID: AAP16724
UniProt: P0AFA4
Position
complement(1271349..1273145)
Genome map
AA seq 598 aa AA seqDB search
MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL
LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR
ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ
PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG
LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF
TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ
LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG
DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV
KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG
VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacgttgtctctctccgctcaccctggttaatcaggttgcgcttattgtgttg
ctttctactgctattggactggcagggatggcggtttctggctggctggtgcaaggcgtt
cagggcagcgcccatgcgatcaacaaagcgggatcgctgcgcatgcaaagttaccgtctg
ttggcggcagtgccattaagcgagaaagacaagcccttaattaaagagatggaacaaacg
gcatttagcgccgagttgactcgagcagcagaacgagacggacaactggcgcaattacag
ggcttacaagattactggcgtaatgaactgatccctgcgctgatgcgtgcacaaaaccga
gaaacggtgtcagcggatgtcagccagtttgttgccgggcttgatcagctggtatctggt
tttgaccgcaccacggaaatgcgtattgagacagtggtactggtccatcgggtaatggcg
gtatttatggcacttttactggtgttcactattatctggttgcgggcgcgactgctacaa
ccgtggcggcaactgctggcaatggcgagtgccgtcagccatcgcgattttacccaacgc
gcaaacatcagcgggcgcaacgaaatggcgatgcttggaactgcgttgaacaatatgtct
gcagaactggccgaaagttatgccgtacttgagcagcgggttcaggagaaaaccgccggg
ctggagcataaaaatcagatcctctcttttttatggcaggctaaccgccgtttgcattcc
cgcgccccgctgtgtgaacgcctgtcaccggtactcaacggcttacagaatttaaccctg
ctacgtgatatcgaactgcgggtgtatgacactgatgatgaagagaatcatcaggagttt
acctgccagccagatatgacttgtgatgataaaggctgccagctctgcccgcgcggcgta
ttacccgttggtgatcgcggcacgaccctgaagtggcggctggctgactctcatacgcag
tacggtattttgctggcgaccctgccgcaggggcgtcatcttagccatgaccaacaacaa
ctggtggataccctggttgaacaacttaccgccacgctggcgctggatcgccatcaggaa
cgtcagcaacagttgatcgtgatggaagagcgtgccaccattgcgcgcgaactgcatgat
tctattgcccaatctctctcttgcatgaagatgcaggtgagttgtttacagatgcagggc
gatgcgctgccagaaagcagccgcgaactgttaagtcagatccgtaacgaactgaatgca
tcctgggcgcagttgcgtgaattgctcaccacattccgcttgcagctcaccgagcctgga
ttacgtccggcgctggaagcgagttgcgaagagtacagcgccaaatttggcttcccggtg
aagctggattatcaattgccgcctcgtctggtgccttcacatcaggcaatccacttgttg
caaattgcccgtgaggcattaagtaacgccctcaaacattcgcaagcgagtgaggtcgtg
gtgacggtggcgcaaaacgataatcaggtcaaactgaccgtccaggataacggctgtggc
gtgcctgaaaatgccatccgcagcaatcactacggcatgataataatgcgcgaccgtgcg
caaagtttacgaggcgattgccgcgtccgccgtcgtgaatcaggtggcaccgaagtggtg
gtcacctttattcccgaaaaaactttcacagacgtccaaggagatacccatgagtaa

DBGET integrated database retrieval system