KEGG   Shigella flexneri 2457T (serotype 2a): S1351Help
Entry
S1351             CDS       T00128                                 

Gene name
trpC
Definition
(GenBank) N-(5-phosphoribosyl)anthranilate isomerase and indole-3-glycerolphosphate synthetase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01130  Biosynthesis of antibiotics
sfx01230  Biosynthesis of amino acids
Module
sfx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S1351 (trpC)
Enzymes [BR:sfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     S1351 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     S1351 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAP16763
UniProt: A0A0H2UYX7
Position
complement(1314614..1315975)
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLLIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSAL
MAHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKAL
SVGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgc
aaacagcagcaaccgctggccagttttcagaatgaggttcagccgagcacacgacatttt
tatgatgcgctacagggtgcacgcacggcgtttattctggagtgtaaaaaagcgtcgccg
tcaaaaggcgtgatccgtgatgatttcgatccggcacgcattgccgccatttataaacat
tacgcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttc
ctcctcatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgac
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaccaatatcgccagcttgcagccgtcgctcacagtctggagatgggg
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattaggggcaaag
gtcgttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtaacggtaatcagcgaatccggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttg
atggcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagta
tgtggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
gtggacaaagctaaggtgttatcgctggcggcagtgcaactgcatggcaatgaagatcag
ctgtatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcatta
agcgtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagac
aacggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system