KEGG   Shigella flexneri 2457T (serotype 2a): S1385Help
Entry
S1385             CDS       T00128                                 

Gene name
ycjL
Definition
(GenBank) probable amidotransferase subunit
  KO
K09473  gamma-glutamyl-gamma-aminobutyrate hydrolase [EC:3.5.1.94]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00330  Arginine and proline metabolism
sfx01100  Metabolic pathways
Module
sfx_M00136  GABA biosynthesis, prokaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    S1385 (ycjL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfx01002]
    S1385 (ycjL)
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.94  gamma-glutamyl-gamma-aminobutyrate hydrolase
     S1385 (ycjL)
Peptidases and inhibitors [BR:sfx01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   S1385 (ycjL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C26 GATase
Motif
Other DBs
NCBI-ProteinID: AAP16796
UniProt: Q83LB6
Position
1355245..1356021
Genome map
AA seq 258 aa AA seqDB search
MRLSMENIMNNPVIGVVMCRNRLKGHATQTLQEKYLNAIIHAGGLPIALPHALAEPSLLE
QLLPKLDGIYLPSSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICRG
LQELVVATGGSLHRKLCEQPELLEHREDPELPVEQQYAPSHEVQVEEGGLLSALLPECSN
FWVNSLHGQGAKVVSPRLRVEARSPDGLVEAVSVINHPFALGVQWHPEWNSSEYALSRIL
FEGFITAWQHHIAEKQRL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagattgagcatggaaaatataatgaacaatccggttatcggtgtcgtaatgtgcagg
aacaggcttaagggtcatgcgacccagactctgcaagaaaagtacctgaatgccatcatc
cacgcaggcggcttgccaattgcgctaccacatgcgctggcggaaccgtcgttacttgaa
caacttttgccgaaactcgatggcatttatcttcctagtagtcccagcaatgtgcagccg
cacctatatggtgaaaacggcgatgagcctgacgccgatcccgggcgtgatcttctgagc
atggcgataattaatgccgcactcgaaaggcgcatccccattttcgccatctgccggggt
ttacaagaactggtggtggcaaccggtggttcgttgcatcgcaagctgtgcgaacagcct
gaattgctggaacatcgggaagatcccgaactgccggtggaacagcaatatgcaccgtcg
catgaagttcaggttgaagaggggggattactgtctgcgttgttacctgaatgtagcaac
ttttgggtaaactctctacatggacaaggggcgaaggtcgttagcccacggttgcgtgtt
gaagctcgctcgccggatggcttagttgaggcggttagcgtcatcaatcatccttttgcg
ctgggcgtacagtggcacccggaatggaacagtagcgagtacgcgctttcgcgtatattg
ttcgagggctttatcaccgcttggcagcaccatatcgctgaaaaacagcgactctga

DBGET integrated database retrieval system