KEGG   Shigella flexneri 2457T (serotype 2a): S2203Help
Entry
S2203             CDS       T00128                                 

Gene name
hisD
Definition
(GenBank) oxidoreductase for L-histidinal:NAD+ and L-histidinol:NAD+
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00340  Histidine metabolism
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01230  Biosynthesis of amino acids
Module
sfx_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    S2203 (hisD)
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     S2203 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: AAP17450
UniProt: P59401
Position
2080348..2081652
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSADEIAAASERLSDELKQAMAVAVKSIETFHTAQKLPPVDVETQLGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCDVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETTRQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNVLKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccctgcgtgaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgatgagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagagtattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagctaggcgtgcgttgccagcaggtc
acgcgcccggtggcttcagtgggtttgtatattccgggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgaaattctttatgcggcgcagctgtgcgatgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggattttgtggcttctgatttgctttctcaggct
gaacacggccctgactcacaggtaattttactgacccccgatgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccacccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggcgac
tacgcctccggcaccaaccacgtgctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgtccttaaggagcaagcatga

DBGET integrated database retrieval system