KEGG   Shigella flexneri 2457T (serotype 2a): S2470Help
Entry
S2470             CDS       T00128                                 

Definition
(GenBank) putative membrane protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00052  Galactose metabolism
sfx00500  Starch and sucrose metabolism
sfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    S2470
   00500 Starch and sucrose metabolism
    S2470
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     S2470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AAP17752
UniProt: A0A0H2VWU9
Position
2457501..2458934
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALALGDDNDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWAFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRRISNKYVLQENAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLILWRYYPHENLDGYRSIPLPQRD
TLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcatgagcaccgg
ggtaacactttctatccccattttcacctcgcgcctcctgccggatggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcacccgatgagc
gaacactggggaccaatgcactggggacatgccaccagtgacgatatgatccactggcag
catgagcctattgcgctagcgctaggagacgataatgacaaagacgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagatcca
ggcaacacggggcagatcctgctttatcgcggcagttcattgcgtgaatgggccttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacgggcatgacttttatgcaccacaa
agctttttagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaacttctacaacgcccggttcacgaagctgagtcgttacgccagcag
catcaatctgtctctccccgcagaatcagcaataaatatgttttgcaggaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
cagctcggcactggaatgcggctgtatattgataaccaatctgagcgacttattttgtgg
cggtattacccacacgagaatttagacggctaccgtagtattcccctcccgcagcgtgac
acgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactgtcgctttat
gcctcccacggagtggctgtgctgcaacatggagcactctggctactgggttaa

DBGET integrated database retrieval system