KEGG   Shigella flexneri 2457T (serotype 2a): S2517Help
Entry
S2517             CDS       T00128                                 

Gene name
hisP
Definition
(GenBank) ATP-binding component of histidine transport
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    S2517 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfx02000]
    S2517 (hisP)
Enzymes [BR:sfx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     S2517 (hisP)
Transporters [BR:sfx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    S2517 (hisP)
   Histidine transporter
    S2517 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 PRK G-alpha AAA_33 RsgA_GTPase AAA_24 FtsK_SpoIIIE DUF87 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AAP17713
UniProt: A0A380APR1
Position
complement(2411305..2412078)
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaataaattaaacgttatcgatttgcacaaacgctatggcgaacacgaagtg
ctgaaaggggtctcactgcaagcgaatgccggagatgtaataagcatcatcggatcgtcg
ggatcggggaaaagtacctttctgcgctgcattaacttcctcgaaaaaccgagtgaagga
tcgatcgtggtcaatggccagacgatcaatctggtgcgcgacaaagacggtcaactcaaa
gtcgccgataaaaatcaactgcgcttactgcgcacacgcctgacgatggtattccagcac
ttcaatctctggagccatatgacggtgttggaaaacgtcatggaagcgccgattcaggtg
ttgggcctgagcaagcaggaagcgcgcgagcgggcggtgaagtatctggcgaaagtcggg
atagacgaacgtgcgcaggggaaatatccggtgcatctttccggcggtcagcaacagcgt
gtttctatcgcgcgggcgctggcgatggaaccagaagttttactgtttgatgaacctacc
tcggcgctcgatcctgaactggtaggcgaagtgttacgtattatgcagcaactggcagaa
gaggggaaaaccatggtggtagtgactcacgaaatgggctttgctcgccatgtttctact
cacgtcattttcctccatcaggggaaaatagaagaagagggcgcgccggagcagttattt
ggcaacccgcaaagccctcgtctgcaacagttccttaagggatcgctgaaataa

DBGET integrated database retrieval system