KEGG   Shigella flexneri 2457T (serotype 2a): S3052Help
Entry
S3052             CDS       T00128                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00071  Fatty acid degradation
sfx00280  Valine, leucine and isoleucine degradation
sfx00310  Lysine degradation
sfx00362  Benzoate degradation
sfx00380  Tryptophan metabolism
sfx00620  Pyruvate metabolism
sfx00630  Glyoxylate and dicarboxylate metabolism
sfx00640  Propanoate metabolism
sfx00650  Butanoate metabolism
sfx00900  Terpenoid backbone biosynthesis
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01120  Microbial metabolism in diverse environments
sfx01130  Biosynthesis of antibiotics
sfx01200  Carbon metabolism
sfx01212  Fatty acid metabolism
sfx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S3052 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    S3052 (yqeF)
   00640 Propanoate metabolism
    S3052 (yqeF)
   00650 Butanoate metabolism
    S3052 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    S3052 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    S3052 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S3052 (yqeF)
   00310 Lysine degradation
    S3052 (yqeF)
   00380 Tryptophan metabolism
    S3052 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S3052 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S3052 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    S3052 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfx04147]
    S3052 (yqeF)
Enzymes [BR:sfx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S3052 (yqeF)
Exosome [BR:sfx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S3052 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AAP18166
UniProt: A0A0H2V1J1
Position
complement(2939453..2940634)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system