KEGG   Shigella flexneri 2457T (serotype 2a): S3070
Entry
S3070             CDS       T00128                                 

Definition
(GenBank) putative dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00230  Purine metabolism
sfx01100  Metabolic pathways
sfx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    S3070
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AAP18178
UniProt: A0A3T6J7Z8
Position
2955582..2956061
AA seq 159 aa
MNHSETITTECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGTVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccaccgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcaca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system