KEGG   Shigella flexneri 2457T (serotype 2a): S3133Help
Entry
S3133             CDS       T00128                                 

Gene name
speA
Definition
(GenBank) biosynthetic arginine decarboxylase
  KO
K01585  arginine decarboxylase [EC:4.1.1.19]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00330  Arginine and proline metabolism
sfx01100  Metabolic pathways
Module
sfx_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    S3133 (speA)
Enzymes [BR:sfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     S3133 (speA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: AAP18235
UniProt: Q83Q93
Position
complement(3014414..3016390)
Genome map
AA seq 658 aa AA seqDB search
MSDDMSMGLPSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVC
PDPDVPEARVDLAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDY
FLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYI
RLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQGSGKWQSSGGEK
SKFGLAATQVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKL
GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITE
SGRAVTEHHTVLVSNIIGVERNEYTVPTAPVEDAPRALQSMWETWQEMHEPGTRRSLREW
LHDSQMDLHDIHIGYSSGTFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQER
MADKMYVNFSLFQSMPDAWGIDQLFPVLPLEGLDQVPERRAVLLDITCDSDGAIDHYIDG
DGIATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELS
DEGDTVADMLQYVQLDPKTLLTQFRDQVKKTDLDAELQQQFLEEFEAGLYGYTYLEDE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgacatgtctatgggtttgccttcgtcagcgggcgaacacggtgtactacgc
tccatgcaggaggttgcaatgagctcccaggaagccagcaagatgctgcgtacttacaat
attgcctggtggggcaataactactatgacgttaacgagctgggccacatcagcgtgtgc
ccggacccggacgtcccggaagctcgcgtcgatctcgcgcagttagtgaaaactcgtgaa
gcacagggtcagcgtctgcctgcactgttctgtttcccacagatcctgcagcaccgtttg
cgttccattaacgccgcgttcaaacgtgcgagggaatcctacggctataacggcgattac
ttccttgtttatccgatcaaagttaaccagcaccgccgcgtgatcgagtccctgattcat
tcgggtgaaccgctgggtctggaagccggttccaaagccgagttgatggcagtgctggca
catgctggcatgactcgtagcgtcatcgtctgcaacggttataaagaccgcgaatatatc
cgcctggcattaattggcgagaagatggggcacaaggtctatctggtcattgagaagatg
tcagaaatcgccattgtgctggatgaagcagaacgtctgaatgtcgttcctcgtctgggc
gtgcgtgcacgtctggcttcgcagggctcgggtaaatggcagtcctccggcggggaaaaa
tcgaagttcggcctggctgcgactcaggtactgcaactggttgaaaccctgcgtgaagcc
gggcgtctcgacagcctgcaactactgcacttccacctcggttcgcagatggcgaatatt
cgcgatatcgcgacaggcgttcgtgaatccgcgcgtttctatgtggaactgcacaagctg
ggcgtcaatattcagtgcttcgacgtcggcggcggtctgggcgtggattatgaaggcacc
cgttcgcagtctgactgctccgtaaactatggcctcaatgaatacgccaacaacatcatc
tgggcgattggcgatgcgtgtgaagaaaatggtctgccgcatccgacggtaatcaccgaa
tcgggccgtgcggtgactgagcaccataccgtgctggtgtcgaatatcatcggcgtggaa
cgtaacgaatatacggtgccgaccgcgcccgtagaagatgcgccgcgtgcgctgcaaagc
atgtgggaaacctggcaggaaatgcacgaaccgggaactcgccgttctttgcgtgaatgg
ttacacgacagccagatggatctgcacgacattcatatcggctactcttccggcaccttt
agcctgcaagaacgtgcatgggcagaacaactctatctgagcatgtgccatgaagtgcag
aagcaactggatccgcaaaaccgtgcgcatcgtccgataatcgacgaactgcaggaacgt
atggcggacaaaatgtacgtcaatttctcgctgttccagtcaatgccggacgcatggggg
atcgaccagttgttcccggttctaccgctggaagggctggatcaagtgccggaacgtcgc
gctgtgctgctggatattacctgtgactctgacggtgctatcgaccactatattgatggt
gatggtattgccacgacaatgccaatgccggagtacgatccagagaatccgccgatgctc
ggtttctttatggtcggtgcatatcaggagatccttggcaatatgcacaacctgttcggt
gataccgaagcagttgacgtgttcgtgttccctgacggtagcgtagaagtagaactgtct
gacgaaggcgataccgtggcggacatgctgcaatatgtacagctcgatccgaaaacgctg
ttaacccagttccgcgatcaagtgaagaaaaccgatcttgatgctgaactgcaacaacag
ttccttgaagagttcgaggcaggtttgtacggttatacttatcttgaagatgaataa

DBGET integrated database retrieval system