KEGG   Shigella flexneri 2457T (serotype 2a): S3142Help
Entry
S3142             CDS       T00128                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00270  Cysteine and methionine metabolism
sfx00480  Glutathione metabolism
sfx01100  Metabolic pathways
Module
sfx_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    S3142 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S3142 (gshB)
Enzymes [BR:sfx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     S3142 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AAP18244
UniProt: Q83Q91
Position
3022370..3023320
Genome map
AA seq 316 aa AA seqDB search
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK
QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFSDLTPETLVTRNXAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL
GVIAETLTEHGTCYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
ITGMLMDAIEARLQQQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggcatcgtgatggaccccatcgcaaacatcaacatcaagaaagattcc
agtttcgctatgttgctggaagcacagcgtcgtggttacgaacttcactatatggagatg
ggcgatctgtatctgatcaatggcgaagcccgcgcccatacccgcacgctgaacgtgaag
cagaactacgaagagtggttttcgttcgtcggtgaacaggatctgccgctggccgatctc
gatgtgatcctgatgcgtaaagacccgccgtttgataccgagtttatctacgcgacctat
attctggaacgtgccgaagagaaagggacgctgatcgttaacaagccgcagagcctgcgc
gactgtaacgagaaactgtttaccgcctggttctctgacttaacgccagaaacgctggtt
acgcgcaataragcgcagctaaaagcgttctgggagaaacacagcgacatcattcttaag
ccgctggacggtatgggcggcgcgtcgattttccgcgtgaaagaaggcgatccaaacctc
ggcgtgattgccgaaaccctgactgagcatggcacttgctactgcatggcgcaaaattac
ctgccagccattaaagatggcgacaaacgcgtgctggtggtggatggcgagccggtaccg
tactgcctggcgcgtattccgcaggggggcgaaacccgtggcaatctggctgccggtggt
cgcggtgaacctcgtccgctgacggaaagtgactggaaaatcgcccgtcagatcgggccg
acgctgaaagaaaaagggctgatttttgttggtctggatatcatcggcgaccgtctgact
gaaattaacgtcaccagcccaacctgtattcgtgagattgaagcagagtttccggtgtcg
atcaccggaatgttaatggatgccatcgaagcacgtttacagcagcagtaa

DBGET integrated database retrieval system