KEGG   Shigella flexneri 2457T (serotype 2a): S3639Help
Entry
S3639             CDS       T00128                                 

Gene name
sorB
Definition
(GenBank) putative sorbose-permease PTS system IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00051  Fructose and mannose metabolism
sfx01100  Metabolic pathways
sfx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S3639 (sorB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    S3639 (sorB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfx02000]
    S3639 (sorB)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     S3639 (sorB)
Transporters [BR:sfx02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    S3639 (sorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AAP18683
UniProt: A0A379YMY7
Position
3520706..3521200
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgtctgatccacggccaggtcactaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagtgcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaataggc
accctgaatattggcggcatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatcttggtgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system