KEGG   Shigella flexneri 2457T (serotype 2a): S4491Help
Entry
S4491             CDS       T00128                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00230  Purine metabolism
sfx00240  Pyrimidine metabolism
sfx01100  Metabolic pathways
sfx03030  DNA replication
sfx03430  Mismatch repair
sfx03440  Homologous recombination
Module
sfx_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    S4491 (holC)
   00240 Pyrimidine metabolism
    S4491 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S4491 (holC)
   03430 Mismatch repair
    S4491 (holC)
   03440 Homologous recombination
    S4491 (holC)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     S4491 (holC)
DNA replication proteins [BR:sfx03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     S4491 (holC)
DNA repair and recombination proteins [BR:sfx03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     S4491 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AAP19437
UniProt: A0A0H2V5E6
Position
4395488..4395931
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGSAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcaactggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcagtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system