KEGG   Shigella flexneri 2457T (serotype 2a): S4675Help
Entry
S4675             CDS       T00128                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00230  Purine metabolism
sfx00240  Pyrimidine metabolism
sfx01100  Metabolic pathways
sfx03030  DNA replication
sfx03430  Mismatch repair
sfx03440  Homologous recombination
Module
sfx_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    S4675 (holD)
   00240 Pyrimidine metabolism
    S4675 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S4675 (holD)
   03430 Mismatch repair
    S4675 (holD)
   03440 Homologous recombination
    S4675 (holD)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     S4675 (holD)
DNA replication proteins [BR:sfx03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     S4675 (holD)
DNA repair and recombination proteins [BR:sfx03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     S4675 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: AAP19593
UniProt: A0A0H2V3V6
Position
4566825..4567238
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIASPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgagcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcattggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system