KEGG   Shigella flexneri 2457T (serotype 2a): S4693Help
Entry
S4693             CDS       T00128                                 

Gene name
nadR
Definition
(GenBank) probable nadAB transcriptional regulator
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00760  Nicotinate and nicotinamide metabolism
sfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    S4693 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfx03000]
    S4693 (nadR)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     S4693 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     S4693 (nadR)
Transcription factors [BR:sfx03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    S4693 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 Citrate_ly_lig HTH_26 CTP_transf_like MMR_HSR1 FAD_syn HTH_37 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AAP19610
UniProt: A0A0H2W026
Position
4585051..4586304
Genome map
AA seq 417 aa AA seqDB search
MRDTEGDMSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHR
FLGLEFPRQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSA
MSQQPTVPDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPD
LIYTSEEADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRT
VAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQ
YIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVA
DGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEDDYDSRFLRCVELVREMMGEQG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagagatacggagggagatatgtcgtcatttgattacctgaaaactgccatcaagcaa
cagggctgcacgctacagcaggtagctgatgccagcggtatgaccaaagggtatttaagc
cagttactgaatgccaaaattaaaagccccagcgcgcaaaagctggaggcattgcaccgt
tttttggggcttgaatttccccggcagaagaaaaccattggtgtcgtattcggtaagttc
tacccgctgcataccggacatatctaccttatccagcgcgcctgtagccaggttgacgag
ctgcatatcattatgggttttgacgatacccgcgaccgcgcgttgtttgaagacagcgcc
atgtcgcagcagcccacggtgccggatcgtctgcgctggctattgcaaacctttaaatat
cagaaaaatatccgtattcatgctttcaacgaagagggcatggagccgtatccgcatggc
tgggatgtgtggagcaacggcatcaaaaagtttatggctgaaaaggggatccagccggac
ctgatctacacctcggaagaagccgatgcgccacagtatatggaacatctggggatcgag
acggtgctggtcgatccgaaacgtacctttatgagtatcagcggtgcgcagatccgcgaa
aacccgttccgctactgggaatatattcctaccgaagtgaagccgttttttgtgcgtacc
gtggcgatccttggcggcgagtcgagcggtaaatccaccctggtaaacaaacttgccaat
atcttcaacaccaccagtgcgtgggaatatggccgcgattatgtcttttcacacctcggc
ggtgatgagatcgcattgcagtattccgactacgataaaatcgcgttgggtcacgcacaa
tacattgattttgcagtgaaatacgccaataaagtggcgtttattgacaccgattttgtc
actacccaggcgttctgcaaaaagtacgaagggcgtgagcatccgttcgtgcaggcgctg
attgatgaataccgtttcgatctggtgatcctgctggagaacaacacgccgtgggtggcg
gatggtttacgcagcctcggcagttcggtggatcgcaaagagttccagaacttgctggtg
gagatgctggaagagaacaatatcgaattcgtgcgggttgaagaggacgattacgacagc
cgtttcctgcgctgcgtggagctggtgcgggagatgatgggggagcaaggataa

DBGET integrated database retrieval system