KEGG   Streptococcus gallolyticus UCN34: GALLO_0055Help
Entry
GALLO_0055        CDS       T01171                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GALLO_0055 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sga03011]
    GALLO_0055 (rplV)
Ribosome [BR:sga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GALLO_0055 (rplV)
  Bacteria
    GALLO_0055 (rplV)
  Archaea
    GALLO_0055 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBI12547
Position
66960..67304
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARVVEKVLNSAIA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtccgtgtttcacctcgtaaa
acacgtcttgtacttgatcttatccgtggtaagaatgttgctgacgcaatcgcaatcttg
aaattcactccaaacaaagcagctcgcgtagttgaaaaagttcttaactctgctatcgct
aacgcagaaaacaactttggtttggaaaaagctaacttggtagtatctgaaactttcgca
aacgaaggaccaactatgaaacgtttccgtccacgtgctaaaggttcagcttcaccaatc
aacaaacgcacaactcacgtcacagtagttgtgtcagaaaaataa

DBGET integrated database retrieval system