KEGG   Streptococcus gallolyticus UCN34: GALLO_0586Help
Entry
GALLO_0586        CDS       T01171                                 

Gene name
trpC
Definition
(GenBank) indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01130  Biosynthesis of antibiotics
sga01230  Biosynthesis of amino acids
Module
sga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GALLO_0586 (trpC)
Enzymes [BR:sga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GALLO_0586 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CBI13078
Position
610116..610883
Genome map
AA seq 255 aa AA seqDB search
MSREFLPTILKQKAKEVEELETESLQPLRETYKLYDYLKNNAKKLQVIAEVKKASPSLGD
INLDVDIVKQTKTYQDSGAAMISVLTDPFFFKGDIDYLRQISSQVSIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALSEARLKELYDFATGLGLEVLLETHNLPELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSAHFKEMPVYISESAIFTKDDAALVAPFFNGILVGTALMKA
DNVSEKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagaatttctcccaactatcttgaagcaaaaagcaaaagaagtggaagagtta
gaaacggaatccttacaaccacttcgtgagacttacaagctgtatgactatctcaaaaat
aatgccaagaaacttcaagtgattgctgaagttaaaaaagctagtcctagccttggtgac
attaatcttgatgtcgacattgtcaaacaaactaaaacttaccaagatagcggtgcggca
atgatttcggtgctgacagaccctttcttctttaaaggtgacattgattacctccgtcag
atttctagtcaagtgagtattccaacgcttgccaaagatttcattattgatgaaaaacaa
atcattcgtagtcgtaatgcaggagcaacagtgattttgttgattgtggcagctttgtca
gaagctcgcttgaaagagctttatgattttgcgacagggttaggactagaagttttactc
gaaacgcataatttacctgaattggaagtcgcacatcgcattggtgctaaaattatcggc
gttaacaatcgtaatttagtgacttttgaaacagatatcaataccagtttggaattatca
gcgcatttcaaagaaatgccagtttatatttcagaatcagctattttcaccaaagacgac
gctgccttggttgccccatttttcaatggcatcttggttggcacggcattgatgaaagca
gataatgtttctgaaaaagtgaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system