KEGG   Streptococcus gallolyticus UCN34: GALLO_1843Help
Entry
GALLO_1843        CDS       T01171                                 

Definition
(GenBank) putative desuccinylase, deacetylase or peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00300  Lysine biosynthesis
sga01100  Metabolic pathways
sga01120  Microbial metabolism in diverse environments
sga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GALLO_1843
Enzymes [BR:sga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GALLO_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CBI14334
Position
complement(1916335..1917717)
Genome map
AA seq 460 aa AA seqDB search
MVVSDNNQLQKFENDDVAQYYFEILRQLIAKKSIFAQQIGLAEVANYLGDIFTEAGAEVT
IDDTCTAPFVLARFKSNRPDAQTIIFYNHYDTVPADDDQPWSSNPFELTIRDGYMYGRGV
DDDKGHITARLTAVQKYRREFGDFPVNIIFIMEGSEESASVGLETYLDKYANELRGADLL
VWEQGISNAKGQIEISGGTKGIVTFDMIVDSAKVDIHSKFGAVIESASWYLLNAIASLRD
ETGRILVDGIYDQVIEPSERELSLILEHANLDADNLKTLYGLNLPMLTRDKEKLVRTLFF
EPAITIEGISTGYQGQGVKTILPAKAQAKMEVRLVPGLEPKDVLQKIEQHLQQHGFEQVE
LVYTLGEKAYRSDMSAPAILNVIEIAKVFSPNGVSVLPTTAGTGPMHQFFEALEVPIASF
GIGNPDSRDHAGDENVNLADYYTHIEMIEELIKSYDKTDY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaagtgataataatcagttgcagaagtttgaaaatgatgacgttgctcaatat
tattttgagattttacgtcagttaattgctaaaaaatcgatttttgcacagcagattggg
ttagcagaagtagcaaattatctaggcgatatttttactgaagctggtgctgaagtgacg
attgatgatacttgtacggcgccgtttgttttggcacgttttaagagcaatagacctgat
gctcagacgattattttttacaaccattatgatactgtgccagctgatgatgaccagcct
tggtcgtcaaatccttttgaattaaccatccgtgatggctacatgtatggacgtggtgtt
gatgacgataaagggcatatcacagcacgcttgacagccgttcagaagtatcgccgtgag
tttggagattttccagttaacattatatttattatggaaggttcggaagaatcagcttct
gtgggtcttgaaacctatcttgacaaatacgctaatgagctccgtggcgcggatttattg
gtgtgggagcaaggtatttcaaatgccaaaggtcagattgaaatttctggtggaacaaaa
ggtattgtcacctttgatatgattgttgattctgctaaggttgatattcattcgaaattt
ggtgcggtcattgagtcagcatcatggtatttgcttaatgcgattgctagccttcgtgat
gaaactggtcgcattttggttgacgggatttatgaccaagtcattgagccaagtgagcgt
gagttgtcacttatcctagaacatgccaatcttgatgccgataacctaaaaacactatat
ggtttgaatttgccaatgttgacaagggataaggaaaagttagttcgaacgcttttcttt
gaaccagctatcacgattgagggaatttcaacaggatatcaaggtcaaggtgtcaaaacg
attctaccagctaaagctcaggctaaaatggaagttcgtttggttcctgggcttgaacca
aaagatgttcttcagaaaattgaacaacatttgcaacaacatggctttgaacaggtggag
ttggtttacacattgggcgaaaaggcatatcgtagtgatatgtctgccccggctattctc
aatgtgattgagattgcaaaggtattttcaccaaatggtgtttcagttttgccgacgact
gctggtactggaccaatgcaccaattctttgaagcattagaagttccgattgcttctttt
ggtattggcaatccagacagccgtgaccatgctggagatgaaaatgttaatttggcggat
tattacacccacattgaaatgattgaggagttgattaagagttatgacaaaaccgattat
taa

DBGET integrated database retrieval system